KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2298Help
Entry
Synpcc7942_2298   CDS       T00300                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Synpcc7942_2298
Enzymes [BR:syf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Synpcc7942_2298
DNA repair and recombination proteins [BR:syf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Synpcc7942_2298
    RecFOR pathway proteins
     Synpcc7942_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2368966..2369589
Genome map
AA seq 207 aa AA seqDB search
MIGYLQGSLAGVRKQSGRLLLLLDVQGVGYEVQTPARSLVELPAAGQSLQVFTHLQVRED
QWLLFGFLQMAERDLFRQLISVSGIGPQLGLALLDSLSLAELVQAIVAGNTRLLSRTPGV
GAKTAERLALELRSKLAEWREEAGLLPSATAAPIAAVQEDVEMTLLALGYNNREILQALT
AIAQENLVQSGQPAEDWIREAIAWLSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatctccaaggttctctggctggcgttcgcaagcagagcggccgactcttg
ctcttattagatgtgcagggagttggctacgaagtgcaaacaccagcgcgatcgctggta
gagctgcctgccgctggtcaatccctacaagtgttcacccatcttcaggtccgagaagat
cagtggctgctgtttggtttcttgcaaatggcagagcgcgatctgtttcggcagctgatc
agcgtcagcgggattggcccccagttggggctagcgctgctcgacagtttaagtctggcg
gaattagtgcaggcgatcgtggcgggcaatacgcgtctgctgagccggactcccggcgtt
ggtgcgaagaccgcagaacgactcgccttggagttgcgtagcaaattagcggagtggcgc
gaagaggcgggcctgctccccagtgcgacggcagccccgatcgcagcagtacaggaggat
gtggaaatgaccctgctggcgctgggatacaacaatcgcgaaatcctgcaagccttgacc
gcgatcgcccaagaaaatcttgtccagtcggggcagcccgccgaagattggattcgtgaa
gcgatcgcatggcttagccgttga

DBGET integrated database retrieval system