KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2298Help
Entry
Synpcc7942_2298   CDS       T00300                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2368966..2369589
Genome map
AA seq 207 aa AA seqDB search
MIGYLQGSLAGVRKQSGRLLLLLDVQGVGYEVQTPARSLVELPAAGQSLQVFTHLQVRED
QWLLFGFLQMAERDLFRQLISVSGIGPQLGLALLDSLSLAELVQAIVAGNTRLLSRTPGV
GAKTAERLALELRSKLAEWREEAGLLPSATAAPIAAVQEDVEMTLLALGYNNREILQALT
AIAQENLVQSGQPAEDWIREAIAWLSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattggctatctccaaggttctctggctggcgttcgcaagcagagcggccgactcttg
ctcttattagatgtgcagggagttggctacgaagtgcaaacaccagcgcgatcgctggta
gagctgcctgccgctggtcaatccctacaagtgttcacccatcttcaggtccgagaagat
cagtggctgctgtttggtttcttgcaaatggcagagcgcgatctgtttcggcagctgatc
agcgtcagcgggattggcccccagttggggctagcgctgctcgacagtttaagtctggcg
gaattagtgcaggcgatcgtggcgggcaatacgcgtctgctgagccggactcccggcgtt
ggtgcgaagaccgcagaacgactcgccttggagttgcgtagcaaattagcggagtggcgc
gaagaggcgggcctgctccccagtgcgacggcagccccgatcgcagcagtacaggaggat
gtggaaatgaccctgctggcgctgggatacaacaatcgcgaaatcctgcaagccttgacc
gcgatcgcccaagaaaatcttgtccagtcggggcagcccgccgaagattggattcgtgaa
gcgatcgcatggcttagccgttga

DBGET integrated database retrieval system