KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2303Help
Entry
Synpcc7942_2303   CDS       T00300                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2371417..2372253
Genome map
AA seq 278 aa AA seqDB search
MSDRSTLQWGQRTYLMGVINVTPDSFSDGGQFLDPAIAVAQGQALWQAGADILDIGGQST
RPGAETVPLAVELARVIPVVRSLRAELGSKPILSVDTTRVEVAAAALAAGADWINDISGG
TFEPEILSLAAERQAPIVLMHLRGTPQTMQQLTDYDDVVTAVQTSLVERREAAIAAGVQP
ERIILDPGIGFAKTAEQNLELLRRQRELTTLGCPLLVGVSRKSFIGKILNQPDPQQRVWG
TAAACSAAIAQGADILRVHDVAAMVDVARVADAIWRSP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgctcaaccctgcagtggggccaacggacctacctgatgggggtgatcaac
gtgacgcccgatagctttagcgatggtggccagttcttagatcccgcaatcgccgttgcc
caaggtcaagcgctctggcaagccggagcggacattctcgacatcggtggtcagtcaact
cgcccgggagccgaaaccgtgcccttggcggttgagctagcgcgggtgatccctgttgtg
cgatcgctgcgggcagagctgggatcaaagccgatcctctcggtcgatacaacgcgggta
gaggtcgcggctgcagccctcgcagcaggtgcagactggatcaatgacatttccgggggg
actttcgagcctgaaattctctcactggcagccgaacggcaggcaccgatcgtgttgatg
catctgcgcggcacaccacaaaccatgcagcaactgaccgactacgacgatgtcgtcaca
gccgtacaaaccagcttggtagaacggcgtgaggcagcgatcgcggcgggggtgcaaccg
gagcggattattctcgatccggggatcggctttgccaaaacggctgaacaaaacttggaa
ctcctgcgacgtcagcgagaattgaccacgctcggctgcccgctgttggtaggtgtctcc
cgcaagagctttattggcaaaatccttaatcagcccgatccccagcaacgcgtctggggg
acggcagcggcttgtagcgcagcgatcgcccaaggagccgatattttacgagttcacgat
gtggcggcgatggtcgatgtggctcgagtggccgatgccatctggcgatcgccctaa

DBGET integrated database retrieval system