KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2304Help
Entry
Synpcc7942_2304   CDS       T00300                                 

Gene name
ppnK
Definition
inorganic polyphosphate/ATP-NAD kinase (EC:2.7.1.23)
Orthology
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Synpcc7942_2304 (ppnK)
Enzymes [BR:syf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     Synpcc7942_2304 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2372353..2373270
Genome map
AA seq 305 aa AA seqDB search
MPDVGIIYNDSKPRACTIAEELQQQLQDRGWGVRLATSQSGLLGYSNPDTVICHTPVESL
VPRGFDASLRWAIVLGGDGTVLAAARQLAPIGVPMLTVNTGHLGFLAEAYLDSLPAAIEQ
LCKGEYSIEERTMMEVKVLRRELIRWEALSLNEMALHREPLTSMCHFEVAIGKHVPVDIA
ADGVIVSTPTGSTAYSLSSGGPVVTPDVPVFQLVPICPHSLASRALVFANREPMTIFPAT
PERLMMVVDGNAGCYVWPEERVLIQRSRYPAQFIRLQPNEFFRVLREKLGWGLPHVAKPS
APDQS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgccagatgttggcattatctacaacgacagcaaaccgagagcctgcacgatcgctgaa
gaattgcagcagcaactccaagatcgcggctggggtgtccgtttagcaacaagccagtcc
ggcttgctgggctattccaatcccgacaccgtcatctgccatacccccgtcgagagttta
gtgccacgcggctttgatgcgagtctccgctgggcgatcgtcttgggaggtgatggaaca
gtcctcgcagcagctcggcaactagctccgattggcgtacccatgctgactgtcaatacg
ggacatttaggatttttagctgaggcttatctcgacagcttacccgctgcgattgagcag
ctttgcaaaggcgaatacagcatcgaagagcgcacgatgatggaagtcaaagtgttgcgc
cgtgagttgattcggtgggaagcactgtcattgaatgaaatggcactacaccgtgagcca
ctgacaagtatgtgtcattttgaggtggcgatcggcaaacatgttccggttgatattgcg
gcggatggggtaattgtttctacgcccacgggctcaactgcttactctctcagctctggt
ggtcctgttgtgaccccggatgttcccgtctttcaattggtgccgatttgtccgcattcc
ctcgcctcacgcgccttggtttttgcgaatcgggaacccatgaccatttttccagcaaca
ccggaacgcttgatgatggtggtcgatggcaatgccggttgctatgtttggccagaagag
cgggtgttaatccagcgatcgcgctaccctgcgcagtttattcgtttgcagccaaatgaa
ttctttcgagttttgcgagaaaagttgggttggggacttccccatgttgccaagcctagc
gcacccgatcaaagctag

DBGET integrated database retrieval system