KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2304Help
Entry
Synpcc7942_2304   CDS       T00300                                 

Gene name
ppnK
Definition
inorganic polyphosphate/ATP-NAD kinase (EC:2.7.1.23)
Orthology
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:syf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2372353..2373270
Genome map
AA seq 305 aa AA seqDB search
MPDVGIIYNDSKPRACTIAEELQQQLQDRGWGVRLATSQSGLLGYSNPDTVICHTPVESL
VPRGFDASLRWAIVLGGDGTVLAAARQLAPIGVPMLTVNTGHLGFLAEAYLDSLPAAIEQ
LCKGEYSIEERTMMEVKVLRRELIRWEALSLNEMALHREPLTSMCHFEVAIGKHVPVDIA
ADGVIVSTPTGSTAYSLSSGGPVVTPDVPVFQLVPICPHSLASRALVFANREPMTIFPAT
PERLMMVVDGNAGCYVWPEERVLIQRSRYPAQFIRLQPNEFFRVLREKLGWGLPHVAKPS
APDQS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgccagatgttggcattatctacaacgacagcaaaccgagagcctgcacgatcgctgaa
gaattgcagcagcaactccaagatcgcggctggggtgtccgtttagcaacaagccagtcc
ggcttgctgggctattccaatcccgacaccgtcatctgccatacccccgtcgagagttta
gtgccacgcggctttgatgcgagtctccgctgggcgatcgtcttgggaggtgatggaaca
gtcctcgcagcagctcggcaactagctccgattggcgtacccatgctgactgtcaatacg
ggacatttaggatttttagctgaggcttatctcgacagcttacccgctgcgattgagcag
ctttgcaaaggcgaatacagcatcgaagagcgcacgatgatggaagtcaaagtgttgcgc
cgtgagttgattcggtgggaagcactgtcattgaatgaaatggcactacaccgtgagcca
ctgacaagtatgtgtcattttgaggtggcgatcggcaaacatgttccggttgatattgcg
gcggatggggtaattgtttctacgcccacgggctcaactgcttactctctcagctctggt
ggtcctgttgtgaccccggatgttcccgtctttcaattggtgccgatttgtccgcattcc
ctcgcctcacgcgccttggtttttgcgaatcgggaacccatgaccatttttccagcaaca
ccggaacgcttgatgatggtggtcgatggcaatgccggttgctatgtttggccagaagag
cgggtgttaatccagcgatcgcgctaccctgcgcagtttattcgtttgcagccaaatgaa
ttctttcgagttttgcgagaaaagttgggttggggacttccccatgttgccaagcctagc
gcacccgatcaaagctag

DBGET integrated database retrieval system