KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2612Help
Entry
Synpcc7942_2612   CDS       T00300                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00260  Glycine, serine and threonine metabolism
syf00750  Vitamin B6 metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01230  Biosynthesis of amino acids
Module
syf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Synpcc7942_2612
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Synpcc7942_2612
Enzymes [BR:syf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Synpcc7942_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ABB58642
JGI: Syn_pcc79422612
CyanoBase: Synpcc7942_2612
CYORF: Synpcc7942_2612
UniProt: Q31JX7
Position
2693828..2694928
Genome map
AA seq 366 aa AA seqDB search
MTATYPSEAQPQSRAHGWPGLIEAYRDYLPVTDTTPIVTLHEGNTPLIPVPTIAREIGRG
VEVFVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAF
VLIPDGFVAQGKLAQALLYGAEVLAIKGNFDRALEIVREVANQYPVTLVNSLNPYRLEGQ
KTAAFELIDVLGEAPDWLCIPMGNAGNISAYWMGFQEYHAKGLSQKLPRMMGFQAAGSAP
LVTGEIVQSPDTIATAIRIGNPANWQRALRVHEESNGAFNAVTDAEILDAYRMLAGQEGI
FCEPASAASVAGMLKCKDEIPDGATIVCVLTGNGLKDPSSAIEFSHTGFKAGIEPDLDIV
AHTMGF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaacgtatccgtctgaagcccaaccccaaagccgtgcccacggttggcccgga
ctgatcgaagcctaccgcgactacctccccgtcaccgacacgacgccgatcgtcacgctg
cacgagggtaatacgcccttgattcctgtgccgacgatcgcccgtgaaattggtcgcggc
gtggaagttttcgtcaaatatgatggcctcaatcccacaggcagctttaaagatcgtggg
atgacgatggcgatcaccaaggccaaagaagcgggtgcaaaagcggttatctgcgccagt
actggcaacacttcggcggcggcagcagcctacgcaagacgtggcggcctgcgtgctttt
gtcttgattccggatggttttgttgcccaaggcaagctagcccaagccctgctctacggg
gcagaagtgctggcgatcaaaggcaacttcgatcgagctctcgaaatcgttcgcgaagtc
gctaaccagtacccagtcaccctcgttaactcgctcaatccctatcgtttagaagggcaa
aaaacagctgcctttgagttgattgatgtgctcggcgaagcccccgattggctctgtatt
cccatgggcaatgcaggcaacatcagtgcctattggatgggctttcaggaatatcatgct
aaggggttgagccaaaaactgccccgcatgatgggttttcaagcggcgggttcagcgcct
ctagtcaccggagaaattgtgcaatcgcccgatacgatcgcaacagcaattcggattggt
aatccagcgaactggcaacgtgccctcagagtgcatgaggaaagtaatggtgccttcaat
gcagtgaccgatgctgaaattcttgatgcctatcgcatgctggctggtcaggagggtatc
ttctgtgagcctgccagtgcagcttccgtcgctggcatgctgaagtgcaaagatgaaatc
ccagacggcgctacgatcgtctgcgttctgactggtaatggcctcaaggatcccagcagt
gcgatcgaatttagccacacaggtttcaaagctggaattgagcctgatttagatatcgtg
gctcacaccatgggcttttaa

DBGET integrated database retrieval system