KEGG   Synechococcus sp. CC9311: sync_0029Help
Entry
sync_0029         CDS       T00390                                 

Gene name
gap-1
Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sync_0029 (gap-1)
   01230 Biosynthesis of amino acids
    sync_0029 (gap-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_0029 (gap-1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    sync_0029 (gap-1)
Enzymes [BR:syg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     sync_0029 (gap-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
34373..35398
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGRLDPS
VDIKTTDDSMFINGKEIKFFADRNPLNCPWKEWGVDLVIESTGVFNTDEKASMHIQAGAK
KVILTAPGKGAGVGTFVVGVNDDQYRHEDWDILSNASCTTNCLAPIVKVLDQNFGMEWGL
MTTIHSYTGDQRILDNNHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGTSKGPSVEEVKAAMKSASENGMKGIIKYTDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKGWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgccatcaatggattcggccgaattggtcgcaatgtgctgcgaggt
tggatcagccgcggtgctgacactggtctggaaatcgtgggtatgaactccacgtctgat
cccaagaccagcgctcacctactcacctacgactcgattttgggtcgcttggacccatca
gtggatatcaaaaccactgatgactccatgttcatcaatggcaaggaaatcaaattcttc
gccgatcgcaaccccctcaattgcccttggaaggaatggggtgttgatctggtcatcgaa
tcaaccggtgtgttcaacactgatgaaaaggccagcatgcacatccaggctggtgccaag
aaggtgattcttaccgctcctggtaagggtgctggggtcggcacgttcgtggttggagtc
aacgacgatcagtatcgccacgaagattgggacattctcagcaacgcaagttgcaccacc
aattgcctggcgccaatcgtcaaggttctggatcagaatttcggcatggaatggggcttg
atgaccaccattcacagctataccggtgaccaaagaattctggataacaaccatcgcgac
ttgcgtcgtgcccgtgcagcagcgctgaacatggtgcccaccacaacgggtgcagctaag
gctgttgccctggtgtaccccgaagtgaagggtaagctcactggcttcgccatgcgcgtt
cctactccgaatgtgtccgctgttgacctgacctttggaacatccaagggcccaagtgtt
gaggaggtcaaagctgccatgaagagcgcctctgaaaacggcatgaagggaatcatcaag
tacaccgacttgcccctcgtttccaccgactacgccggcacgaacgaatcgaccatcttt
gacgctgatctcacctatgcgatgggcgacaaagctgtgaaaattcttgcttggtatgac
aacgagtggggctacagccagcgtgtcgttgacttggctgaggttgttgccaaaggctgg
aagtaa

DBGET integrated database retrieval system