KEGG   Synechococcus sp. CC9311: sync_0248Help
Entry
sync_0248         CDS       T00390                                 

Gene name
chlD
Definition
magnesium chelatase, ATPase D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sync_0248 (chlD)
Enzymes [BR:syg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     sync_0248 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(256242..258323)
Genome map
AA seq 693 aa AA seqDB search
MVASGVTSNGVISTAALNQASRAFPLAAITGHGTLKLALLLAAVDPGLGGVIIAGGRGTG
KSVLARGLHALIPPIEVVDLEAAGETKLPGRNLDPQDVQDWGERQQDPPKTVIPAPFIQI
PLGVTEDRLVGSVDVTASLASGSPVFQPGLLAEAHRGVLYVDELNLLDDGIINLLLAAVG
SGENQVEREGLSLSHPCRPLLIATYNPEEGAIRDHLLDRFAIVLSANQIVSTEQRVEITN
AVLAHGQCSRSFSDKWSEETDALATQLLLARQWLPDVQISSNQIEYLVTEAIRGGVEGHR
SELYAVRAAKAHAALSGRDQVEAEDLQVAVALVIAPRASQLPPPEQQMEPPPPQDQQPPP
PPEGSGEEEEQESEEQESEDNSDDDDDTPEEQPPPSVPEEFMLDPEAVAIDPDLLLFNAA
KSKSGNSGSRSVVLSDSRGRYVKPMLPRGPVRRIAVDATLRAAAPYQKARRARQPDRIVI
VEESDLRAKLLQRQAGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRDEVALIPF
RGDQAEVLLPPTRSITAARRRLESMPCGGGSPLAHGLTQAARVGANALATGDLGQVVVVA
ITDGRGNVPLSTSLGQPVLEGEEKPDLKQEVLDVATRYRMLGLKLLVIDTERKFIGSGMG
KDLAEAAGGKYVQLPKASDQAIAAVAMDALNTV
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaagcggggtgacatcaaacggagtcatcagcacggcggcgctgaatcaagcc
agccgggcttttccgctggcggccattaccggccacggcaccctcaagctggccctgctg
ttggcagcggtagatccaggcttaggcggagtgatcattgctggcgggcgtgggacaggt
aagtcggtgctggctcgaggcttgcatgccctgatccctcccatcgaggttgttgacctt
gaagcagctggagagaccaagctgccaggacgcaacctcgatccgcaggatgtccaggat
tggggcgaacggcagcaagatccacccaaaacagtgattccagcaccgtttatccagatt
ccccttggcgttacggaagatcgcctggtgggctccgtggatgtcaccgcctccttggcc
agtgggtcacccgttttccagcctggattactggcagaagcacaccgcggtgtgctctac
gtcgatgagctgaacctgctcgacgatgggatcatcaatctgttgcttgccgctgttggc
agcggcgaaaaccaggtggaacgagaagggctcagcctgagccacccctgccggccactg
ctgattgccacctacaaccccgaagaaggggccatccgagatcacctattggatcgcttt
gcgatcgtcttatccgccaatcaaatcgttagcactgagcaacgagtggagatcaccaac
gcggtcctggcccacggtcaatgcagccggagcttctccgacaagtggagcgaagaaacc
gacgctctcgccacccaactgctcctggcgcggcaatggctaccggatgtacaaatcagc
agcaatcagatcgaatatctggtgactgaggccattcgcggtggggtggaagggcatcgc
tccgagctctacgccgtgcgtgccgccaaagcccatgccgccctcagcgggcgcgatcag
gtggaagcagaggacttacaagtcgctgttgcgctggtgatcgccccacgcgcttctcaa
ctgcccccacctgaacaacagatggagccaccaccaccccaggatcaacaaccaccgcca
ccacctgagggctcaggggaagaggaagagcaggaaagcgaagaacaggagagtgaagac
aacagcgacgatgatgacgacacccccgaagagcagccaccaccgtcggtgccggaggag
ttcatgctcgatccagaggccgtagcgattgatcctgatctgctgctgttcaacgctgcc
aagagcaaaagcggcaacagcggcagccgctccgtcgtcctcagtgacagccgtggccgc
tatgtgaaaccgatgttgccccgcggtcccgtgcgccgcatcgctgttgacgccaccttg
cgcgctgctgccccgtatcaaaaggcgcggcgagcgcggcagcctgaccgcatcgtcatc
gttgaagaatccgacctccgagccaagctgctgcaacgccaggccggtgccctggtgatc
tttctggtggatgccagtggttcgatggctctgaaccgcatgcagagcgccaaaggagcc
gtcatccgactcctcacagaggcctacgaaaaccgcgacgaggtggcactcatccccttc
cgcggtgatcaagctgaagtgctgctgccccctacccgctcgattacggccgcgcggcga
cgcctggaatccatgccctgtggcggtggctcaccgctggcccacggcctcacccaagcc
gcccgggttggtgccaatgcccttgcaacaggcgatctcggccaagtggtagtggttgca
atcacggatggtcgaggcaatgttcccctcagcacctcccttggacaaccggtgctggag
ggagaggaaaagcccgatctcaagcaagaagtgctggatgtggccacccgttatcggatg
ttgggtctcaagctgctggtgatcgacaccgaacgcaaattcatcggtagcggcatggga
aaagatctcgccgaagccgcgggaggcaagtatgttcaactccccaaagcaagcgatcag
gcgattgccgccgtcgccatggatgccctgaacacggtttaa

DBGET integrated database retrieval system