KEGG   Synechococcus sp. CC9311: sync_0249Help
Entry
sync_0249         CDS       T00390                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syg  Synechococcus sp. CC9311
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    sync_0249 (folK)
Enzymes [BR:syg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     sync_0249 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
258384..258893
Genome map
AA seq 169 aa AA seqDB search
MALGSNQDGPCGSPLRTLMAVRPLLEGLLGLWAQSVEEISPGDTAPNGVSSPLTFSWSPL
QQTAPVGGPIDQPSYLNAVLLVKGLELCPESATALRLLDALQQLEQSFGRNRSQEERWGP
RPLDLDLLFWGDWRLDHPRLTLPHPRLHLRSFVMEPLLAAMQASTPWLS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggccctgggttccaatcaggacggcccttgtggctcgccgctgcggactctcatggca
gtgaggcctttgctggagggtttgttgggcctttgggctcagtccgtggaagagatcagt
ccaggggacactgctccgaacggtgtctcttcgccactgaccttctcttggtccccgttg
cagcaaaccgcacctgtgggtggaccaatcgatcagccctcctatctcaatgccgttctg
ctggtgaaaggccttgagctgtgccctgaatcggccactgcgttgcgtttgctggatgcc
ctccaacagttggagcaatcgttcgggcgcaaccgctctcaagaggaacgatggggaccg
cgacctttggatctcgatttgttgttttggggagattggcgtttggatcatccgcgcttg
acgctgccgcacccccgcttgcatttgcgcagttttgtgatggagccattgctggcggcc
atgcaggcttcaacgccctggctgagctga

DBGET integrated database retrieval system