KEGG   Synechococcus sp. CC9311: sync_0361Help
Entry
sync_0361         CDS       T00390                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
syg  Synechococcus sp. CC9311
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
365053..366873
Genome map
AA seq 606 aa AA seqDB search
MRQQFAELCSIPDALGKGTVSKLLMAHKWLPSLLTELYEHHSSEDLNLLSSQLLHSERSA
SEKAVSESLDVGSADATATGARWDSSSCVLIAYADTVSADDQPGLRCLQALLHEHFNGLS
SVVHVLPFLRSTSDGGFAVASHEEIEQRFGDWNDLAALAEGRQLMADLVLNHISASHPWV
RAFLKGEQPGARCVLAAAPNPCWDNVVRPRSSALFTTLATDRGPETVWTTFGPDQVDVNW
REPEVLLGFTRLLDLFCSYGVQWLRLDAVGFVWKEPLSDCIHQPQAHRLVEVLRLLLESR
CPQGVVVTETNVPEQENLSYLTTGSEAHLAYNFPLPPLVLEACLSRRADLLNNWLARWPQ
LPQGTGLLNFTACHDGIGLRPLEGLMESDRLLQLLKQCEQRGGLVSHRRLADGLEVPYEI
NISWWSAMAAPGRDPSHHQRARFLLTQLLLLTLPGVPAFYLPALLATPNDNARFLLSGHR
RDLNRPQFQLDRLERLLVDVESDTPQVVASLQQAMAVRRGQAALDPFAPMKVLSEGRSDL
VILQRGEGASTLFAIHNFSDVRLSFPLSTLANATGCVWHDVLKGHSLVAGQTALDLEPFA
VHWLTR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaacaatttgcggagctctgttccatacctgatgcacttggcaaaggcacggtg
tcgaagctgttaatggcgcataagtggttgccatcgcttctgacggagctctatgaacac
cattcttcggaggatctcaatctgctgtcgtcgcaattgctgcattccgagcggtccgct
tcggagaaggccgtttcagagtcgcttgatgttgggagtgcggacgcaacggcaacgggt
gcgcgttgggattcctcgagttgtgtgttgattgcctatgccgatacggtgagtgccgat
gatcagcctgggctccgttgtttgcaggcccttcttcacgagcatttcaacgggctctca
tccgtcgtgcatgtgttgcccttcttgcgctcaaccagtgatggcggttttgccgttgcc
agtcatgaggagattgaacaacgcttcggtgattggaatgacttggccgcgttagctgaa
ggccgccagttgatggctgatttggttctcaatcacatttcagcgtctcacccttgggtg
cgagctttcctgaagggagagcaacctggagcgcgatgtgtgttggctgctgctcccaac
ccttgttgggacaatgtggtgcgcccgcgtagctcagccctcttcaccacattggcaaca
gatcggggcccagaaacggtctggaccacgttcggacccgatcaagttgatgtgaactgg
cgagagcctgaagtgttgttggggttcacacgactgctcgatcttttttgcagttatggc
gtccaatggttgcgccttgatgccgtggggtttgtttggaaagagcctttgagtgattgc
atccatcagcctcaggctcatcggttggtggaagtgttgcgtcttctcttggagtcgcga
tgtcctcagggagtggtggtgacagagacgaatgtcccggagcaggaaaatctgtcttat
ttgaccacgggttctgaagcgcacctcgcctacaacttcccattacctccgctggtcctc
gaggcatgtctcagtcgtcgtgctgatctgctgaacaactggctggcgcgttggcctcag
ctccctcagggaacaggcctgctcaatttcacggcatgtcatgacgggattggtttgcgg
ccactcgaagggctgatggaatccgatcgcttgctccagttgctgaagcaatgcgagcag
aggggtggcttggtgagtcaccggcgcttggcggatggactggaggttccttatgaaatc
aacatcagctggtggagtgccatggcggctccagggagggatccatcacaccatcaacga
gcgcgttttttgttgacgcaattgttgctgttgacgttgcccggtgtgcctgcgttttat
ttgccggcgttattggcaactcctaatgacaatgccagatttctcctcagcggtcatcgg
cgcgatctcaaccgtcctcaatttcaactcgaccgcctagagcgtttgttggttgatgtt
gaaagcgatacccctcaggtggtggcgtcactgcaacaagcgatggctgtccgtcgtggc
caggcggcgctagatcccttcgccccaatgaaggtcctgagcgaagggcgctctgatctg
gtgattctgcagaggggtgaaggggcaagcactctgtttgcgattcacaatttcagtgat
gttcgcctcagtttccctttaagcacccttgctaacgccacagggtgtgtttggcatgac
gttttgaaaggacattctcttgttgccggccaaacggctctcgatcttgagccgtttgct
gtgcattggttaactcgatga

DBGET integrated database retrieval system