KEGG   Synechococcus sp. CC9311: sync_0569Help
Entry
sync_0569         CDS       T00390                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:syg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(546771..548282)
Genome map
AA seq 503 aa AA seqDB search
MAMAAPPLLLALDQGTSSSRAALFDTDGRPVASASAPLEIHYPADGWVEQSPSAIWESQR
LAMSRLEQAITPEQRQAVISCGITNQRETTTLWKRSDGSPCGPALVWQDGRTADLCKQWK
ASGLETSWRARTGLMLDPYFSASKIRWLLDHESAASSAAAQGDLCFGTVDSWLLWQLSGG
TVHATDMSNASRTLLMDLKQRQWIDDACAEIGLPKQALPELRPCRGDFGVIQAGLPFAGV
PIQALLGDQQAATLGQLCLQPGEGKCTYGTGAFLVVNTGATIRHSDAGLLSTLGWTDQHG
TPTYCLEGSLFNAGTVVQWLRDGLGIIRSAEEVNPLAQEVENSAGVMLVPAFTGWGTPHW
DPSARGLLIGITRDTRRGHIARAALEGIAFSVASLVELAEQSMEQSLGELAVDGGAAASD
LLLQAQADSTGLNVRRPVHLESTARGVALLAGLQAGAIADLKDLVPNRTQDSRVFEPLQT
LEQRQHWRQRWNDAVSRSLHWNG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcagcaccgcccctcctgctcgcactagatcaaggcaccagcagctcacgc
gctgctttattcgatacggatggccgcccagtcgctagcgcttccgccccccttgaaatt
cactaccccgccgatggctgggtggaacaaagcccctcggcgatctgggaaagccagcgc
ctggcgatgagccgccttgagcaggcgattactccagagcagcgccaagccgtaatcagc
tgcggcattaccaatcagcgcgaaaccaccacgctctggaaacgaagcgatgggagcccc
tgcggcccagccctggtttggcaggacggtcgcaccgccgatctctgtaagcaatggaag
gcaagcggccttgaaacgagctggagagctcgaaccggcctaatgctcgacccctatttc
agcgcgagcaaaattcgctggcttctcgaccatgagtccgccgcaagcagcgccgctgcc
cagggtgatctctgctttggaactgtggacagctggctcctatggcagctcagtggcgga
acagtccatgccacagacatgagcaatgccagccgcaccctgctaatggatctgaaacag
cggcaatggatcgatgatgcttgcgctgaaattggcttaccgaagcaggccctcccagag
ctcaggccctgccgtggagatttcggcgtcatccaagcaggtttgcccttcgctggcgtg
cccattcaagccctgcttggcgaccaacaggccgcaaccctggggcaactctgcctgcaa
ccaggcgaaggcaaatgcacctacggcaccggcgcctttctcgtagtaaacaccggtgca
accatccgccattccgacgctggcctactcagcaccctgggctggaccgatcagcacggg
acacccacctattgcttagagggaagcctgttcaatgcgggcacggtggtgcaatggctg
cgcgacggccttggcattattcgaagtgccgaggaggtcaatcccctggcgcaagaggtg
gagaactctgccggggtgatgcttgttccagccttcaccggatggggcacacctcactgg
gaccccagtgcccgtggtctcttgatcgggatcacccgcgacacccgccgaggccatatc
gcccgagccgccctggaaggaatcgccttctccgtagccagtcttgtggagttggcagag
caatccatggagcaaagcctcggggagcttgctgtggatggaggagcagctgcttccgat
ctgctcttgcaagcccaagccgacagcactggtttaaacgtgcgccgcccagttcacctg
gaaagcaccgctcgtggtgtggccctgttagctggcttacaagccggcgcaattgccgac
ctcaaggacttggtaccgaatcgcacccaagactccagggtgtttgagcccttacaaacc
ctggagcaacgccaacactggcgccagcgttggaacgatgctgtgagtaggagccttcac
tggaatggctga

DBGET integrated database retrieval system