KEGG   Synechococcus sp. CC9311: sync_0589Help
Entry
sync_0589         CDS       T00390                                 

Definition
ARD/ARD' family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
syg  Synechococcus sp. CC9311
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    sync_0589
Enzymes [BR:syg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     sync_0589
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     sync_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(559196..559804)
Genome map
AA seq 202 aa AA seqDB search
MTELRIYATRGAGVEADRDSAVAAAPEALLSTSNAEQISAQLKTRGIKFQRWPSKPKLEQ
GAMQEQILEAYASLIASVQKNEGYQTVDVMRVERDQISGSTLRQTFRQEHQHAEDEVRFF
VEGCGLFALHIKDEVLQVICEANDWIAIPAGTRHWFDMGVDPNYCVIRFFKNSGGWAASF
THDPIADHYPGLDQARKQTTQG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctgaggatttacgcaacgcggggcgcgggtgttgaggcagaccgtgattca
gccgttgctgcagcaccagaggcacttctcagcaccagcaacgctgaacaaatcagcgca
caactcaaaacgcgaggcatcaagtttcagcgttggccaagcaagcccaagcttgagcaa
ggggccatgcaagagcagattttggaggcctatgcatcgctgattgcttccgtccaaaaa
aacgagggttaccaaactgtggatgtgatgcgcgttgagcgcgatcagatcagcggctca
acgttgcgccaaacatttcggcaagagcaccagcatgcagaggatgaagtgcgctttttt
gtggaagggtgcgggctctttgcacttcacatcaaggatgaggtgcttcaagtgatctgc
gaagccaatgattggatcgcaattccagctggaacccggcactggttcgacatgggcgtc
gacccgaactattgcgtgattcgtttttttaaaaactcaggaggatgggcggcgtctttc
acccatgatccgatcgccgatcactatccaggccttgatcaagcaagaaaacagacaacc
cagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system