KEGG   Synechococcus sp. CC9311: sync_0617Help
Entry
sync_0617         CDS       T00390                                 

Definition
(GenBank) 2-oxo acid dehydrogenases acyltransferase (catalytic domain) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00010  Glycolysis / Gluconeogenesis
syg00020  Citrate cycle (TCA cycle)
syg00620  Pyruvate metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
syg01130  Biosynthesis of antibiotics
syg01200  Carbon metabolism
Module
syg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_0617
   00020 Citrate cycle (TCA cycle)
    sync_0617
   00620 Pyruvate metabolism
    sync_0617
Enzymes [BR:syg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     sync_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ABI45271
CyanoBase: sync_0617
CYORF: sync_0617
UniProt: Q0ICI7
Position
588039..589172
Genome map
AA seq 377 aa AA seqDB search
MPAGSTAPVGETIGLIVETEAEIADVKAKAPSSAPAAPAAAAPPAAPAPPTPVSAPAAVS
APAPVTAPVAASVSNGRLIVSPRARKLASQMGVDLAGLRGTGPNGRIQAEDVEKAAGRPV
TPPRVGEGTSAAAVVGDTVSASPSAPSGNSFGAPGDTVAFNTLQAAVNRNMEASLAVPCF
RVGYTITTDKLDAFYKQVKLKGVTMTALLAKAVAVTLARHPQVNAATTASGMSYPAEVNV
AVAVAMEDGGLITPVLRNADRTDLYELSRQWGDLVKRSRSKQLQPEEYSTGTFTLSNLGM
FGVDRFDAILPPGTGAILAVAASRPTVVAGKDGSIAVKRQMQVNLTADHRVIYGADGAAF
LKDLAELIDTRPESLAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgggtagcactgcacctgtgggtgaaacgattggcctgatcgttgagacggaa
gctgagatcgctgatgtgaaggccaaagctccttcttcagctccggccgctccagctgca
gccgccccccctgcggctccagcgccccccactcccgtttcagctcctgctgccgtttca
gctccagctcccgtcacagctccggtggctgcatctgtcagcaacggacgcttgatcgtc
agtccccgcgcccgcaagcttgcctcccaaatgggtgtagaccttgctggtctgcgcggt
actggccccaatggccggattcaggcggaagacgttgaaaaggcagccggacgtcctgtg
accccaccacgggtaggtgaagggacttcagccgctgccgttgttggtgacacagtctcg
gcttcaccgtcggctccttcgggcaacagttttggcgccccaggcgacaccgtggccttc
aacaccctgcaggcggcggtgaaccgcaacatggaagccagtcttgcggtgccttgtttc
cgtgttggatacacgatcactaccgacaagctcgatgccttttacaagcaggtaaaactc
aaaggcgtcacgatgacggcccttctggccaaagctgtggccgttactttggctcgccat
ccccaggtgaatgccgcaaccacggcttctggcatgagctaccccgctgaggtgaatgtg
gctgttgctgtggcgatggaagacggaggcttgattacgccggtattgcgcaatgccgat
cgcaccgatctatatgagttgtcgcgtcagtggggggatttggtgaagcgttctcgcagt
aagcaactgcagcctgaggaatacagcaccggcaccttcaccctctccaaccttggaatg
ttcggagtggatcgatttgatgccattctgcccccaggcaccggcgcaatcctggcggtt
gcggcgtctcgtcccaccgtggtggcaggcaaagacggatccatcgccgtgaagcgtcag
atgcaggtgaatctcaccgctgatcaccgcgtgatttatggcgccgatggtgctgccttc
ctcaaggatcttgcggaactgatcgacacgcgtccggagagtttggctctgtaa

DBGET integrated database retrieval system