KEGG   Synechococcus sp. CC9311: sync_0632Help
Entry
sync_0632         CDS       T00390                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
syg  Synechococcus sp. CC9311
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:syg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:syg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
601045..602556
Genome map
AA seq 503 aa AA seqDB search
MTQRLHALLHSVGLPVPQGLSDAVIESITCDSRCVGPGSVFIGLPGGRVDGGSFWPKALV
DGASAVLIGSAAAATLPPEQSDAVLVVPDPVARWAGELAAAFWNHPSERIGLIGVTGTNG
KTTTTHLIEHLSSACGRPSALFGTLLNRWPGHSVTATHTTAVADRLQAQLAEAYAAGAQL
TAMEVSSHALDQHRVAGCRFSGAVFTNLTQDHLDYHETMASYFEAKARLFAPPLVADQGA
QFVVNIDDPWGKHLAERLGDRCWRSSLSEGSAHAELTMSDLVMGSSGVEGRLLSPLGEGS
FQSPLLGRFNVMNLLQAVGVLLQQGLPLEALLEAISTFRGVPGRMERVVVDGKGGELPTV
LVDYAHTPDGLSSALNACRPFADGKLICVFGCGGDRDRGKRSQMAAIAAELADAVVVTSD
NPRTEDPQQILNDVVEGIPSGTALTVMLDRAEAIAGAIKDAGSHDLVLIAGKGHEDYQIL
GTQKVHFDDREQALKALQDKLIF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagactccacgccctgcttcattcggtgggtttgcctgtgccccaggggttg
tctgatgcagtgatcgaatcgatcacctgtgattcccgttgcgttggccctgggagtgtg
tttatcggtcttcctggcgggcgtgtggatggaggaagcttttggcccaaggcccttgtt
gatggggcttccgcggtcttgattggctctgcggcagcagcaactctgccccctgagcaa
agcgatgcggtgctggtggtgcctgatccggttgctcgctgggccggtgagttggcggca
gctttttggaatcacccaagtgagcgcatcgggttgattggggtcactggcaccaatggc
aaaaccactaccacccatctgattgaacatttgagttcggcctgtggacgtccttctgct
ctgtttggaacccttctcaatcgctggcctggccacagcgttacggcgacacacaccaca
gccgtcgcggatcggctgcaagctcagctcgctgaggcctatgccgctggagctcagtta
acggccatggaggtgagctcccatgcacttgatcagcatcgggtggctggatgtcgtttt
tccggcgctgtgtttaccaatctcacgcaggaccatctcgattaccacgagacgatggcg
tcttatttcgaagccaaagctcggctttttgcaccacctcttgtggctgatcagggggct
cagtttgtggtcaatattgatgatccttgggggaaacacttagcggagcggttgggcgat
cgctgttggcggagttcgttatctgagggttcagcgcatgcagaactgaccatgtctgat
ttggtgatgggctcttctggggtcgaaggccgcctgttgagtcctttgggtgagggatcc
ttccaatcgcctctgctaggtcgcttcaatgtgatgaacctgttgcaggcggttggagtc
ttgcttcagcagggtctccctttggaggcgcttctcgaagccatcagtacattcaggggc
gttcctggtcggatggaacgggtggttgtggacggaaaggggggagagctgcccactgtc
ttggtggattacgcccacactccagatggcttaagcagcgcactcaacgcctgtcggccc
tttgcagatggcaagctgatttgtgtgtttggctgtggtggtgatagagatcgtggcaag
cgttcgcagatggctgcgattgcggcagagcttgctgatgctgtggtggtgacctctgat
aatccacgcacagaagatcctcaacaaatcctgaatgatgttgttgagggaattcctagc
ggcactgcgttaacggtgatgctcgaccgtgctgaagccattgctggtgcgattaaggat
gctggctctcacgatcttgtcctcattgccggtaaaggtcatgaggattatcaaattctg
gggacccagaaagttcattttgatgaccgcgaacaagctctaaaagcactgcaagacaag
ctgattttttaa

DBGET integrated database retrieval system