KEGG   Synechococcus sp. CC9311: sync_0746Help
Entry
sync_0746         CDS       T00390                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syg  Synechococcus sp. CC9311
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syg00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:syg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(698302..699639)
Genome map
AA seq 445 aa AA seqDB search
MMVKMVVNLVTTGMTAAALASQDILKPHLVIDGGEKLSGELRVSGAKNSALVLMTASLLT
EAPLTLRNVPPLTDIGGMTEILSSLGVKVQRSGEVVHLHADQMTGAEPPYELVNGLRASF
FAIGPLLARMGHARVPLPGGCRIGARPVVEHIRGLKALGAVVNVDHGIIAASIPGREQRL
KGAEIVLDCPSVGATETILMAAALAQGTSVISNAAQEPEVQDLANLLIAMGAKITGAGGP
TITVEGVDQLHGCDYTVIPDRIEAGTFLLAAAITRSKLRVAPVIPDHLSAVLQKLRDCGC
KLEIDNEGITITPGEIKGIDITTQPFPGFPTDLQAPFMALLATAQGTSVITEKIYENRMQ
HVAELQRMGASIRVQSNTAVVEGVSALSGAPVNGTDLRASAAMVLAALVANGKSQVSGLE
HLDRGYADIEAKLGRTGAKLTRRTS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgatggtcaagatggtcgtgaatttagtaaccacgggcatgacggcagcggctcttgcg
tctcaagacattctcaagccgcacctcgtgattgatggtggagaaaaattgagcggagag
cttcgcgtcagcggcgcgaaaaattcagccctcgtgctgatgactgcttctctactaacc
gaagcccccctgacgcttcgcaatgtccccccattaacggacatcggcgggatgacagaa
atcctgtcttccctgggcgtcaaggttcaacgcagcggcgaggtggttcacctacatgcc
gatcagatgacgggagctgagcctccctacgaattggtgaatggcctgcgagccagcttt
tttgccattggcccgcttctcgcccgaatgggacacgcgcgggtgccccttccaggggga
tgccgcattggtgcccgtccggtggtggaacacatccgtggattgaaggccctaggagcc
gttgtgaacgtggatcacgggatcattgccgcctcaattccaggcagggagcaacgtctc
aaaggtgcagagatcgtcttggattgcccgagtgtgggcgccacggaaaccattttgatg
gctgcagccttggctcaaggcaccagcgtgatttcgaatgctgcacaggagccagaggta
caggatctcgccaacttgttgattgcgatgggcgccaaaatcaccggggctggtggaccc
accatcaccgtggaaggtgtggatcaactccatggttgcgattacacggtgattcccgac
cgcattgaggctggcacctttctgcttgctgcggccatcacccgctccaagctcagagtg
gcacctgtgattcctgatcatctcagtgcagttctgcagaagttgcgagactgcggctgc
aaacttgagatcgacaacgaagggatcacgattactccaggtgagatcaagggcatcgac
atcactacccaaccgttccctggttttcccaccgatcttcaagcaccgttcatggcctta
ctggccacggcacagggaaccagtgtgatcaccgaaaagatctatgaaaaccgaatgcag
cacgtcgcagagctgcagcgcatgggtgcctccatcagggttcaaagcaacactgcggtc
gtagaaggagtgtccgcactcagcggagctccagtgaatggaaccgatctcagggcctca
gcagccatggtgttggcggcactggtcgcgaatggaaagtcgcaagtgagcggcctcgaa
cacctcgaccgtggctacgccgatatcgaagcgaagctgggtcgtactggagccaaatta
accaggcgtacatcctga

DBGET integrated database retrieval system