KEGG   Synechococcus sp. CC9311: sync_0751Help
Entry
sync_0751         CDS       T00390                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syg  Synechococcus sp. CC9311
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syg01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:syg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
702435..703319
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVQVAHLEYAVPDQDSEPRNILEKIVWEKDREIAVARERMPLEQLRRKVA
DLPPARDFLGALSAAAVRPAVIAEVKKASPSKGVIREDFDPVAIAKAYASGGASCLSVLT
DKAFFQGGFNVLIEVREAVDLPLLCKDFILSPYQLYQARAAGADAALLIAAILTDQDLAY
FAKVAAALGLTVLVEVHDAEELQRVLALGGFPLIGINNRDLTSFETDLATTETLTAQFAE
QLLEQQILLVSESGLFHRADLDRVQAAGAQAVLVGEALMRQADVEAALQSLIHG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgccgtcgtccacccaatcccaaggtgcaagttgcgcatttggagtacgcg
gtccctgatcaggacagcgaacctcgcaatattttggaaaaaatcgtctgggaaaaagat
cgagagatcgcggttgctcgtgagcgcatgccattggagcagttgcgccgcaaggtggcc
gatttgcccccagcccgtgattttctgggcgcgttaagcgctgcagcggtgaggcctgcc
gtgattgctgaggtgaaaaaagcgagtcccagcaaaggtgtgattcgagaggatttcgat
ccagtcgcgattgccaaggcttatgcgtccggtggggcaagctgcctttcggtgctcaca
gataaagcctttttccagggtggtttcaatgtgttgattgaggtgcgcgaagccgtggat
ctcccattgctttgtaaggacttcatcctcagtccctatcagctctatcaggcgcgagca
gctggagccgatgctgcgcttttgattgcggcgatcctcaccgatcaagaccttgcctat
ttcgccaaggtggccgcagcacttggccttacggttttggtggaggtgcatgacgctgaa
gagctgcagcgggtgttggccctgggtggtttccctttgatcggaatcaacaatcgggat
ctcaccagttttgaaacggatttggcaacgactgaaacgctcacggcccaattcgcagag
cagctgttggagcagcagattcttttggtgagcgaatcgggactgttccatcgcgctgat
cttgatcgtgttcaagccgctggagcacaggctgttttggtgggtgaagctctgatgcgg
caagcggatgtggaggcagcactccaatcattgatccatggttga

DBGET integrated database retrieval system