KEGG   Synechococcus sp. CC9311: sync_0827Help
Entry
sync_0827         CDS       T00390                                 

Gene name
est
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
syg  Synechococcus sp. CC9311
Brite
Enzymes [BR:syg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     sync_0827 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
766075..766815
Genome map
AA seq 246 aa AA seqDB search
MSASHQAFSLPGGAVTVVLIHGFTGSPSEMQLLAESLNAQGYGVEVPLLVGHGTTLNDLM
GVHPQQWIDPLDALITRLLSEGQSVVVGGLSLGSILSLQLALRHPQIKALLLYSPPIRSG
DPRRFLAPLLVRFTQSLPKPASDFFDPIAAQRLWSYDRYPVVTSARVLDLISRTRKQLTK
IQQPLLAIASRRDKVISASGIELLMRNVQSSPRELHWLERSGHAITVDAEWTMVRDLSLD
FLRKIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcatcgcaccaggcgttttcactgcctggtggggcagtgactgtcgttctcatt
catggattcaccggttcgccctctgagatgcaactcctcgctgagtccttgaacgcccag
ggttatggcgttgaagtacctctgctcgtgggtcatggaaccactctcaatgatctgatg
ggagttcatccacagcagtggattgacccgctcgatgccttgatcacccgcctgttgtca
gaaggtcagagtgtggtggtgggtggtttgtcgttgggctcaattttgagtttgcaattg
gcgttgcgccatccccaaatcaaggccctcctgctgtattcaccgccgattcgcagcgga
gatccacgccgctttttggccccattgctcgttcgttttacgcaatcgctgccgaagcct
gcctctgatttttttgacccgatcgcggcacagcggctttggtcttacgaccgctatcca
gtggtaaccagtgctcgagttcttgatctcatctctcgcacgcgcaagcagctcaccaag
attcagcaaccgcttttggcgattgcaagtcgtcgcgacaaggtgatttcagccagtggc
attgagctgttgatgcgcaatgtgcagtcctcacctcgagaacttcactggttagagcgc
agcggtcatgcgatcacggtggatgctgaatggacaatggtgcgtgatctcagtctcgac
tttttacgtaagattttttga

DBGET integrated database retrieval system