KEGG   Synechococcus sp. CC9311: sync_0920Help
Entry
sync_0920         CDS       T00390                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syg  Synechococcus sp. CC9311
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    sync_0920 (dxr)
Enzymes [BR:syg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     sync_0920 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(835084..836334)
Genome map
AA seq 416 aa AA seqDB search
MKAISVLGSTGSIGTQTLAIVEDFPDQFRVVALSAGRNLSLLVSQIQRHRPDVVALADQA
LLAELKDRLMALPADTRPEPLPHLVGGPEGLDVVASWDSADLVVTGIVGCAGLLPTLAAI
RAGKDLAVANKETLIAAGPVVLPELKKSGSRLLPADSEHSAIFQCLQGTPWSDTARLSTG
VPTPGLRRIQLTASGGAFRDWSAADLEKATVADATSHPNWSMGKKITVDSASLMNKGLEV
IEAHYLFGLDYDHIEIVIHPQSIIHSMVELADSSVLAQLGWPDMKLPILYCMSWPSRLET
PWRRLDLTEVGQLSFRAPDPAKYPCMDLAYAAGRAGGTMPAVLNAANEEAVAQFLEEKIH
FLDIPKMIEGACEQHKPDLAANPCLDDVLAVDQWARQAVREQVNRGTRLRGASMAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccatcagcgttctgggctccactggatcaattggcacccagacgctggcgatc
gttgaggatttccccgatcaattccgcgtggtggccctcagcgctggacgcaatctcagc
ctgctcgtgtcccaaatccagaggcatcgccctgatgttgtggccctagctgatcaagcg
ctgcttgctgagctcaaagacaggctgatggccctgcctgctgacacccgcccggaacct
ttgccgcacctggtgggtggaccggaaggccttgatgtcgtggcgtcctgggattcagcg
gatctcgttgtcaccggaatcgtggggtgtgcgggattgttacccaccctggcagcgatt
cgagcagggaaagacctggccgttgccaataaggaaacgctgattgccgcaggccctgtg
gtcttacctgaactgaagaaaagcggcagtcggctgcttcctgccgactcggaacactcc
gccatcttccagtgcctgcaaggaactccttggagcgacaccgcccgtctctccaccggg
gttccaacccctggcctgcgccgcattcaactcaccgcctctggtggtgcctttcgcgat
tggtcagccgctgatctcgaaaaggcaacggtggccgatgccacctcccatcccaactgg
agcatgggtaaaaaaatcaccgtggattcagcctcattgatgaataaaggattggaagtg
attgaggctcactatctctttggcctggattacgaccacatcgagatcgtgattcatcct
caaagcatcatccattcgatggtggaacttgctgattcctcggtcctcgcccagctcggc
tggcccgacatgaaactgccgattctctattgcatgagttggccttcaagactggaaacc
ccatggcgacggctcgatctcaccgaagtggggcaattgagtttccgcgcacccgatcca
gccaaatatccctgcatggacctggcctacgccgcgggtcgtgccggcggcaccatgcct
gctgttctcaacgcggccaatgaagaggccgtggcccaattcctcgaggagaagattcac
tttctcgacattcccaagatgatcgagggagcctgtgaacagcacaaacctgatctcgcg
gccaacccttgtcttgatgatgtgttggcggtggatcagtgggcacgccaggctgtgcgc
gagcaagtgaaccgggggacgcgcttgagaggagcatcgatggccgcatga

DBGET integrated database retrieval system