KEGG   Synechococcus sp. CC9311: sync_0962Help
Entry
sync_0962         CDS       T00390                                 

Gene name
chlI
Definition
magnesium chelatase, ATPase I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(869209..870297)
Genome map
AA seq 362 aa AA seqDB search
MSSPRKRRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPG
IEVVAGDPYNSSPTDPDLQSSDVRQRLEHGEALGTEQRQVPMVDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVRDPQLRVKVVDQRTAFDSDPDAFSMS
VTAGQDALQARVVEAQQRLEQVTIDDDLRLSISSVCGELDVDGLRGDIVTNRAARALAAF
EGRTEVSEDDVARVVSCCLRHRLRKDPLEQIDSGDRVVKVFCKVFERNESSDRSEFELAL
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaccgcgcaagcgcagagtctttcccttcaccgccgtcatcggccaggaagag
atgaaattggcgctgctgctcaacgtgatcgacccgcgcattggcggcgtaatgatcatg
ggagaccggggaacgggcaaatccaccacgatccgggcactggcagaccttcttcccgga
attgaggtagttgcaggcgatccctacaacagctctccgaccgatcctgacctgcaaagc
agtgacgtgaggcagcgcttggaacacggcgaagcccttggcacagaacaacgccaggtg
cccatggttgaccttccccttggtgccacagaagatcgcctctgcggcacgatcgacatc
gaaaaggcattgagtgaaggcgtccgcgcctttgaaccaggtttgctcgccaaagccaac
cgcggcctgctttacgtcgacgaagtcaacctgctcgatgatcacctggttgacgttctg
ctcgactccgcagcctctggctggaacacagtggaacgcgagggtgtctccgtgcgtcac
cctgcccgcttcgtgttgattggatcaggcaacccggaagaaggggagcttcggccccaa
ctgctcgatcgatttgggatgagtgtggaagtgcgcaccgttcgcgatccacaattaaga
gtgaaagtggtggatcagcgcacggctttcgacagtgaccccgacgccttcagcatgagc
gtgacggctggccaagacgccctgcaggccagggtggtggaagcgcagcaacgacttgag
caggtcacaattgacgatgacttgcgcctgagcatttcatcagtctgcggagaattggac
gtggatggcttgcgtggcgacattgtgaccaatcgagcagcacgcgccctagccgccttt
gaggggcgcacagaggtcagcgaagacgatgttgcccgcgtggtgtcttgctgcctgcgc
catcgactgcgcaaagaccctttggagcagattgactccggcgatcgggtggtcaaggtg
ttctgcaaggtgtttgaacgcaatgagtcgagcgatcgctcggagttcgaactggccctg
gccagctag

DBGET integrated database retrieval system