KEGG   Synechococcus sp. CC9311: sync_0962Help
Entry
sync_0962         CDS       T00390                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase, ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00860  Porphyrin and chlorophyll metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sync_0962 (chlI)
Enzymes [BR:syg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     sync_0962 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat AAA_29 AAA AAA_18 DUF815 AAA_28 AAA_30 ABC_tran AAA_27 DUF2218
Motif
Other DBs
NCBI-ProteinID: ABI47801
CyanoBase: sync_0962
CYORF: sync_0962
UniProt: Q0IBJ7
Position
complement(869209..870297)
Genome map
AA seq 362 aa AA seqDB search
MSSPRKRRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPG
IEVVAGDPYNSSPTDPDLQSSDVRQRLEHGEALGTEQRQVPMVDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVRDPQLRVKVVDQRTAFDSDPDAFSMS
VTAGQDALQARVVEAQQRLEQVTIDDDLRLSISSVCGELDVDGLRGDIVTNRAARALAAF
EGRTEVSEDDVARVVSCCLRHRLRKDPLEQIDSGDRVVKVFCKVFERNESSDRSEFELAL
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaccgcgcaagcgcagagtctttcccttcaccgccgtcatcggccaggaagag
atgaaattggcgctgctgctcaacgtgatcgacccgcgcattggcggcgtaatgatcatg
ggagaccggggaacgggcaaatccaccacgatccgggcactggcagaccttcttcccgga
attgaggtagttgcaggcgatccctacaacagctctccgaccgatcctgacctgcaaagc
agtgacgtgaggcagcgcttggaacacggcgaagcccttggcacagaacaacgccaggtg
cccatggttgaccttccccttggtgccacagaagatcgcctctgcggcacgatcgacatc
gaaaaggcattgagtgaaggcgtccgcgcctttgaaccaggtttgctcgccaaagccaac
cgcggcctgctttacgtcgacgaagtcaacctgctcgatgatcacctggttgacgttctg
ctcgactccgcagcctctggctggaacacagtggaacgcgagggtgtctccgtgcgtcac
cctgcccgcttcgtgttgattggatcaggcaacccggaagaaggggagcttcggccccaa
ctgctcgatcgatttgggatgagtgtggaagtgcgcaccgttcgcgatccacaattaaga
gtgaaagtggtggatcagcgcacggctttcgacagtgaccccgacgccttcagcatgagc
gtgacggctggccaagacgccctgcaggccagggtggtggaagcgcagcaacgacttgag
caggtcacaattgacgatgacttgcgcctgagcatttcatcagtctgcggagaattggac
gtggatggcttgcgtggcgacattgtgaccaatcgagcagcacgcgccctagccgccttt
gaggggcgcacagaggtcagcgaagacgatgttgcccgcgtggtgtcttgctgcctgcgc
catcgactgcgcaaagaccctttggagcagattgactccggcgatcgggtggtcaaggtg
ttctgcaaggtgtttgaacgcaatgagtcgagcgatcgctcggagttcgaactggccctg
gccagctag

DBGET integrated database retrieval system