KEGG   Synechococcus sp. CC9311: sync_1015Help
Entry
sync_1015         CDS       T00390                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syg  Synechococcus sp. CC9311
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
919441..920967
Genome map
AA seq 508 aa AA seqDB search
MVNHSRSERDRRVGVLLHPTALPDSPVCGSFGRSAREWLKALASHGVSVWQILPLAPPDG
TGSPYSSPSSFALNPWLLDAEDLAEESFLESSDLGRLPGADAKAESPAVLDFHLADARAA
ALARALAAHWPQQSSARQQEFQRWRVDQTHWLTDHVNFVVLRDQHNGLPWWSWPHPLAVQ
QPAALAQWRLQHGEALLEQELLQWHLDRQWQCLRVQARDLNIEILGDLPFYVARDSADVW
SHRSLFSIAADGRLRLQSGVPPDYFSETGQLWGTPVYSWARHRRTGFRWWRNRLRRQWRL
ADRLRLDHFRALAGFWAVPGDDDTAQNGVWQRSPGHELLQLLRRDAGGTLPIVAEDLGVI
TPDVERLRDRFRLPGMKVLQFAFDGNPSNPYLPRNIKGRQWVVYTGTHDNPTTMGWWQRL
DESSRRQVGELLGCHVEAPGWQLMELGMETSAELVVSPLQDLLHLDDQARFNTPGTVGGN
WCWRMSAFDEALQGALKGYGERAAAWGR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggttaatcactccagaagcgaaagggatcggcgggtgggtgtactccttcaccccaca
gctttgccggactcaccggtgtgtggaagctttggacgatcagcccgtgaatggttgaag
gctttggcgagccatggcgtcagcgtttggcagattttgccccttgctccgcctgatggc
acagggtctccgtacagctcaccctccagttttgccttaaatccttggctcctggatgcc
gaagatttggcagaagagagctttttagagtccagtgatctggggcgtctccctggtgct
gatgccaaggcggaatcgcctgccgtactggactttcatctggccgatgcgcgtgctgct
gcactggctcgcgcgcttgcagcccattggcctcagcagtcttctgcgcgtcaacaagaa
tttcaacggtggagggttgaccaaacccattggctcacggatcacgtcaatttcgtggtg
ctgcgtgatcaacacaacggtttgccttggtggtcttggccccatccgctcgcagttcag
caacctgctgccttggctcaatggcgtcttcagcatggtgaagcactgctggagcaggaa
cttcttcagtggcatctcgatcgacagtggcaatgcctgcgcgtgcaagctcgagattta
aacatcgagattcttggtgatctgcccttttatgtggctcgcgatagtgctgatgtttgg
agccatcgatccttattttctattgctgctgatggacgtttacggcttcaaagcggagtg
cctcccgactatttttcggagaccggtcagctctgggggacgccggtttatagctgggct
cgacatcggcgaactggatttcgttggtggcgtaatcgcttaaggcgccagtggaggctt
gctgatcggttgcgcttggatcatttccgcgctttggctggtttttgggcggtccccggc
gatgacgacacggctcaaaatggggtttggcagcgttcacccggccatgagttgttgcag
ctcctgcgtcgagacgcgggagggacgcttcccatcgttgccgaagatcttggcgtgatc
acgccggatgtggaacggctccgtgatcgctttcgtttaccaggaatgaaagttctgcag
ttcgcctttgatggcaacccaagcaacccttatctgccgcgcaatatcaaaggacgccag
tgggtggtgtacaccggtactcatgacaaccccacaacgatggggtggtggcagcgactt
gatgaatcgtctaggcgccaggtgggtgagctgctggggtgtcatgttgaagcacccgga
tggcaattgatggaactcgggatggaaacgtccgctgaactcgtggtgtctccgttacag
gatttgctgcatttggatgatcaagctcgcttcaatactccaggcactgttggcggcaat
tggtgctggaggatgagcgcttttgatgaggccctgcagggtgctcttaagggttatggc
gagagagctgcggcctggggcaggtga

DBGET integrated database retrieval system