KEGG   Synechococcus sp. CC9311: sync_1038Help
Entry
sync_1038         CDS       T00390                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syg  Synechococcus sp. CC9311
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(942161..942730)
Genome map
AA seq 189 aa AA seqDB search
MIDQFERLPGIGPRTAQRLALHLLRQPEEQIHSFADALLAARSQVGQCQTCFHLSAEPTC
EICRNPERSIGMLCVVADSRDLLALERTREYAGRYHVLGGLISPMDGIGPEMLQISNLVK
RVAADEINEVILALTPSVEGDTTSLYLARLLKPFTEVSRIAYGLPVGSELEYADDVTLSR
ALEGRRAVE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaccagttcgaacgtctccctggcattggtccaaggactgcacaacgactggcc
ctccatttgctacgccaaccagaagagcagatccacagttttgctgacgctctcttggcg
gcaaggagtcaggtagggcaatgccaaacctgtttccatctcagtgccgaacccacatgt
gagatttgcaggaatccagagcgctcgatcgggatgctttgcgttgtagccgattcaagg
gatctactggccctcgaacgcaccagggaatatgccggtagataccacgttttgggaggc
ctgatctctccgatggacggcatcggtccggaaatgctgcagatcagcaacctcgtgaaa
agggttgcagcagacgagatcaacgaagtcatccttgcgctcacccccagcgtggaaggt
gataccaccagcctctacctggctcgcctgctcaaaccatttacggaagtcagtcgaatc
gcctacggccttccagttggaagcgaactcgaatacgcggacgacgtcaccttgagtcgg
gctcttgaaggtcgtcgagcagttgaatga

DBGET integrated database retrieval system