KEGG   Synechococcus sp. CC9311: sync_1053Help
Entry
sync_1053         CDS       T00390                                 

Gene name
recD
Definition
exodeoxyribonuclease V, subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syg  Synechococcus sp. CC9311
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sync_1053 (recD)
Enzymes [BR:syg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     sync_1053 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(957654..959333)
Genome map
AA seq 559 aa AA seqDB search
MQSSASDAVIALHRGVLATLQRRMPPEQNSEPLVELLRALTTALSRGEISLQLHDGAKVP
DGIETDGWPRVHREALVASGWLDGDQAVLVLNHNSLSWRRWHGAMQELELELQRRCFQAP
IHATNHGATTSRLSNNNDLSPEQQAAVRAIDRYGVVLLSGGPGTGKTSTVLHMLLRAFEK
QPKLRARLAAPTGKAARRLQDAIRSNPITATLPCTTLHRLLEARPGGFGRHRRNPLELDL
LIVDEMSMVDLELGRALLSALPTHCQLILVGDSAQLPPIGTGAIWQHLQEPNQNRRFKDG
AITLTEVYRNRGALAQMSALLRDQGLIPFWSQLSSLPKTSNITVSYSQTRQIPEAVHAAL
TRHLDHLKEKASALGINAHGQPDQQQAQDLLNILDTLMVLCPRRRGPWGVDAVHQNLLDG
SEPQRWPSGLPVLCSENQPELGLANGDLGVMVGEGVQQRALFLCSDPSGESRHALYHPAR
LRHLEPALALTIHKAQGCEMDKVLLLWPNFDDRQISSLLYTAITRAKQQLLLFADPKALD
LGRSARSWHPEDQSNNGDA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttcagcgtcggatgctgtcattgcccttcaccgtggggtgctagccacactt
caacggcgcatgccgccagagcaaaacagtgaaccactcgtcgagctcctgcgagcactc
acaactgccctgagcagaggcgaaatctcactgcagcttcacgacggcgccaaggttcca
gatgggatcgaaacggatggctggccaagggttcaccgagaagccttagtggctagtgga
tggctggatggtgaccaagcggttttagtcctgaaccacaacagcctgtcgtggcgtcgc
tggcacggagccatgcaagagctcgaactcgaacttcagcgccgctgtttccaggctcca
atccatgccacaaaccacggcgctactaccagccgcctgtccaacaacaacgatctcagt
cctgaacagcaagcggctgtccgtgccatcgatcgctacggcgtggttctgctcagcgga
ggtccaggaaccggcaaaaccagcacggttctgcacatgctgctccgcgcttttgagaag
caacccaagcttcgagcccggctggccgctcccacaggcaaggccgcacgtcgcctccaa
gacgcgattcgcagcaacccaatcaccgcaacattgccctgcaccactcttcatcgtttg
cttgaagcacgccctggaggctttggccgtcaccgacgcaatccgctggagctggaccta
ctcatcgtcgatgaaatgtcgatggtggatttagagctaggccgtgcactgttgagtgca
ctgccaacccattgccaactgatcttggtgggagatagcgctcagctaccaccgattggt
acaggagccatttggcaacatctccaggaaccaaatcaaaacaggcgtttcaaggatggg
gccatcaccctcacagaggtgtatcgcaatcgaggtgccctcgctcagatgagtgcactg
ctccgtgatcaaggcttgataccgttctggtcacaactcagctcgttgcccaaaacctca
aatatcaccgttagttattcccaaacaaggcagatccctgaggctgtgcatgctgcactc
acgcggcatctcgaccatctcaaggaaaaagcaagcgctttagggatcaatgcgcatggg
caacctgatcaacaacaagcccaagatctcctcaacatccttgacaccttgatggtgctc
tgcccgcgtcgacgggggccatggggcgttgatgccgtccaccaaaacttgctcgatggc
tctgaacctcagcgctggccatcgggcctgccagtgctttgcagtgaaaatcagccggaa
ctcggactcgcaaatggagatcttggggtcatggtcggtgagggggttcaacaacgggcc
ctgtttctctgcagcgacccctctggcgagagtcgacatgcgctttaccaccccgcccgt
cttcggcacctcgagcccgctctcgcactcacaattcataaggctcagggctgcgagatg
gacaaagtgctcctgctctggcctaatttcgacgatcgccaaatcagctcgcttctgtac
acagcgatcacccgagctaaacagcaactgcttttatttgcagatccaaaagcgttggat
ctaggccgctcagcccgatcttggcatcctgaggatcaaagcaacaacggggacgcgtag

DBGET integrated database retrieval system