KEGG   Synechococcus sp. CC9311: sync_1210Help
Entry
sync_1210         CDS       T00390                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sync_1210 (tpiA)
   01230 Biosynthesis of amino acids
    sync_1210 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_1210 (tpiA)
   00051 Fructose and mannose metabolism
    sync_1210 (tpiA)
   00562 Inositol phosphate metabolism
    sync_1210 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    sync_1210 (tpiA)
Enzymes [BR:syg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     sync_1210 (tpiA)
Exosome [BR:syg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   sync_1210 (tpiA)
  Exosomal proteins of bladder cancer cells
   sync_1210 (tpiA)
  Exosomal proteins of melanoma cells
   sync_1210 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1089495..1090226
Genome map
AA seq 243 aa AA seqDB search
MRKPVIAGNWKMHMTCAQARAWIGTFLPLIAELPNDRHLVVAPPFTAISTLAELSEGTRL
ELSSQNVHWEGEGAYTAEISPSMLKEHNVQYAIVGHSEPRKYFSESDEQINHRARSAQTN
GLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDPSQLVVAYEPIWAIGTGKTCEASE
ANRICGLIRSWVGSPDLIIQYGGSVKPGNIDQLMGMSDIDGVLVGGASLDPEGFGRIANY
VKS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaaccggtgattgctggaaactggaaaatgcacatgacctgtgcacaagccagg
gcctggattggcacgtttcttcctctcattgcagagcttcccaatgaccgacatttggtg
gtggctccgccatttacggctatcagcacgcttgctgagctgagcgaaggaacccgcctt
gaactgtccagccagaacgtgcactgggagggagagggcgcttacaccgctgagatttcc
ccgagcatgctcaaggagcacaacgtccagtacgcgatcgttggccacagtgagcctcgc
aagtacttcagcgagagtgatgaacagatcaatcatcgggctcgatcagctcaaaccaat
ggattaatcccaattgtttgtgttggtgaaagcgacgagcagcgcagccggggtgaagct
gagcgggtgatccgtcgtcaggttgagcagggcttagaaggtctggaccccagccagttg
gttgtggcttatgagccgatctgggcgattggtaccggcaaaacgtgtgaggcgagtgaa
gccaatcgcatctgcggattgattcgtagctgggttggctcaccagatttgatcattcag
tacgggggttcggtgaaaccaggcaacattgatcagttgatgggcatgagtgatatcgat
ggggttttggttggcggcgcctccctggatcctgaaggttttgggcggatcgcgaattac
gtcaagagctga

DBGET integrated database retrieval system