KEGG   Synechococcus sp. CC9311: sync_1211Help
Entry
sync_1211         CDS       T00390                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syg  Synechococcus sp. CC9311
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1090233..1091066
Genome map
AA seq 277 aa AA seqDB search
MRWPKDWGTRTAVMGVINLTPDSFSDGGQFNQLNRALAEASRQIASGADCLDLGAQSTRP
NAMEVGAEEELKRLLPTLRAIRKEHPEVLISVDTFLAAVANQALEAGADWINDVSGGRRD
PEMFSLIASAGCPFVLMHSRGNSQTMDHCTDYGRTGVVKGVINELRAATEHAQKAGVNQN
QLIWDPGLGFAKTTEQNLALLKQLESIVAEGIPLLLGPSRKRFIGAVLDEPRANARLWGT
AAVCARAVDAGVAILRVHDVGPIHQVVTMASAIASNR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggccgaaggattggggcacgcgcactgccgtgatgggagtgatcaacctcact
cccgattcctttagcgatggtggtcagttcaaccaattgaatagggcattggctgaggcg
tcgcgtcagattgcctctggggcggattgcttggatctgggagcccaaagcaccaggcca
aatgccatggaagtgggagcggaagaagagctcaagcggctgttaccaaccttgagagct
attcgtaaagaacaccctgaggttttgatctcggtggatacctttcttgctgcggtcgcc
aatcaggctcttgaggctggtgctgattggattaatgacgtgagcggtgggcgtcgggac
ccagaaatgttctcgctgattgcaagcgcaggctgcccgtttgtgctgatgcacagtcga
gggaatagtcaaacaatggatcactgcaccgactacggcaggactggagttgtgaaagga
gtcattaatgaattacgagccgctacagagcacgctcaaaaagcaggtgtgaatcaaaat
cagttgatctgggatccaggtctcggatttgccaaaacaaccgagcaaaatttagcccta
ctcaaacagcttgagagcatcgttgctgaaggaattcctctattgctaggtccttcccga
aaacgttttattggggctgttttggacgagccacgagccaatgctcgactatgggggact
gctgcggtgtgcgcacgggcggtggatgcaggtgtggcgatattgcgtgtacacgacgta
gggcctattcaccaagtggtaacgatggcctccgcaattgcttccaatcgctag

DBGET integrated database retrieval system