KEGG   Synechococcus sp. CC9311: sync_1211Help
Entry
sync_1211         CDS       T00390                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syg  Synechococcus sp. CC9311
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    sync_1211 (folP)
Enzymes [BR:syg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     sync_1211 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1090233..1091066
Genome map
AA seq 277 aa AA seqDB search
MRWPKDWGTRTAVMGVINLTPDSFSDGGQFNQLNRALAEASRQIASGADCLDLGAQSTRP
NAMEVGAEEELKRLLPTLRAIRKEHPEVLISVDTFLAAVANQALEAGADWINDVSGGRRD
PEMFSLIASAGCPFVLMHSRGNSQTMDHCTDYGRTGVVKGVINELRAATEHAQKAGVNQN
QLIWDPGLGFAKTTEQNLALLKQLESIVAEGIPLLLGPSRKRFIGAVLDEPRANARLWGT
AAVCARAVDAGVAILRVHDVGPIHQVVTMASAIASNR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggccgaaggattggggcacgcgcactgccgtgatgggagtgatcaacctcact
cccgattcctttagcgatggtggtcagttcaaccaattgaatagggcattggctgaggcg
tcgcgtcagattgcctctggggcggattgcttggatctgggagcccaaagcaccaggcca
aatgccatggaagtgggagcggaagaagagctcaagcggctgttaccaaccttgagagct
attcgtaaagaacaccctgaggttttgatctcggtggatacctttcttgctgcggtcgcc
aatcaggctcttgaggctggtgctgattggattaatgacgtgagcggtgggcgtcgggac
ccagaaatgttctcgctgattgcaagcgcaggctgcccgtttgtgctgatgcacagtcga
gggaatagtcaaacaatggatcactgcaccgactacggcaggactggagttgtgaaagga
gtcattaatgaattacgagccgctacagagcacgctcaaaaagcaggtgtgaatcaaaat
cagttgatctgggatccaggtctcggatttgccaaaacaaccgagcaaaatttagcccta
ctcaaacagcttgagagcatcgttgctgaaggaattcctctattgctaggtccttcccga
aaacgttttattggggctgttttggacgagccacgagccaatgctcgactatgggggact
gctgcggtgtgcgcacgggcggtggatgcaggtgtggcgatattgcgtgtacacgacgta
gggcctattcaccaagtggtaacgatggcctccgcaattgcttccaatcgctag

DBGET integrated database retrieval system