KEGG   Synechococcus sp. CC9311: sync_1553Help
Entry
sync_1553         CDS       T00390                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00010  Glycolysis / Gluconeogenesis
syg00620  Pyruvate metabolism
syg00640  Propanoate metabolism
syg00680  Methane metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
syg01130  Biosynthesis of antibiotics
syg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_1553 (acsA)
   00620 Pyruvate metabolism
    sync_1553 (acsA)
   00640 Propanoate metabolism
    sync_1553 (acsA)
  Energy metabolism
   00680 Methane metabolism
    sync_1553 (acsA)
Enzymes [BR:syg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     sync_1553 (acsA)
Lipid biosynthesis proteins [BR:syg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   sync_1553 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABI47486
CyanoBase: sync_1553
CYORF: sync_1553
UniProt: Q0I9W4
Position
1437426..1439396
Genome map
AA seq 656 aa AA seqDB search
MSEGSTIESVLQEQRVFDPPADLARDARISGMDSYRALAEAAKSDPDTFWGDAARRELHW
FEPFHTVLDWDNPPFARWFEGGTTNLSYNCLDRHLNGPKASKTALIWEGEPGDVRTFTYQ
ELHAEVCRAANALKAIGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSAEAL
RDRLIDGEVKAVITADGGFRKDKPVSLKPAVNAALANSACPTVKSVLVVKRTDQPVEMVD
GRDQWWHELVAHQSDECTAEPMASEDRLFVLYTSGSTGKPKGVVHTTAGYNLWTHLTFQW
IFDIRDDDVFWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWELIQKHRV
SIFYTAPTAIRAFMRSGRAVPDQYDMSSLRLLGTVGEPINPEAWMWYRDVVGGERCPIVD
TWWQTETGGVMISPLPGATPTKPGSATLPLPGIQADIIDAEGNSCGANEGGYLAVRAPWP
GMMRTVHGNPQRFRESYWEAIRPSDGSHLYFAGDGARRDADGYFWVMGRVDDVINVSGHR
LGTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFVTLELGRESNDALVAELRTHVGKE
IGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEEVTGDTSTLEDRSVLDRLRG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagggttccaccattgagagcgtgcttcaagaacagcgtgtctttgatccaccg
gcggacctcgccagggatgcgcgaatttctgggatggactcctatcgcgctctggctgaa
gcggccaaatctgatccagacacgttctggggagacgcggcacgtcgtgaactgcattgg
tttgaaccgtttcacaccgttctcgactgggataaccctccgtttgcacgctggtttgag
ggaggaacaaccaacctgtcttacaactgtcttgaccgtcatctgaatggaccgaaggcc
agcaagacagccctgatctgggagggcgagcccggagatgtgcgcaccttcacctaccaa
gagctgcatgccgaggtttgccgtgctgccaacgcgctaaaggccatcggtataggcaaa
ggcgatctagtcgctctgtacatgcccatggttccggaggccgccatcgcgatgctggcc
tgtgcacgcattggtgctcctcactcagtggtgtttggtgggttctcagcagaagccctg
cgtgatcgtctcatcgatggtgaagtcaaagcggtcatcacggccgatggtggtttccga
aaagacaagcctgtatcgctgaagcctgctgtgaatgcagcgcttgccaacagtgcttgc
ccaacggtgaagtctgtactcgtggtgaaacgcaccgaccaaccggtggagatggtggat
gggcgagatcagtggtggcacgaactcgtggcccatcaatccgatgagtgcaccgctgag
cccatggcgagcgaagaccgcttgtttgtgctttacacctctggatcaaccgggaaaccc
aaaggtgtggtccacaccactgccgggtacaacctctggacccatttgacctttcaatgg
atcttcgacatccgtgacgacgatgtgttttggtgcacggccgatgtgggctggatcact
ggtcacagctacatcgtctacggacctctgtcgaacggtgccaccactgtgatgtacgag
ggtgctcctcgaccctccaagccaggggcgttctgggagctgatccagaaacacagagtc
agcattttctacaccgctcccacggctattcgcgcttttatgaggagtggccgtgcggta
cctgatcagtacgacatgagcagcctgcgcctgctcggcaccgtcggtgagccaatcaac
cctgaagcctggatgtggtatcgcgatgtggtgggcggtgaacgctgtccgatcgtcgac
acctggtggcaaaccgaaaccggtggcgtgatgatcagccctttacctggagcgaccccc
accaaaccaggctctgccaccttgcccttacctgggattcaggccgacatcattgatgca
gagggcaatagctgtggagcaaacgagggcggatacctggcggtgcgagctccttggcca
ggaatgatgcgcaccgttcatggaaatccccagcggttccgggagagctactgggaagcg
attcgcccttcagatggatcgcatctctacttcgctggtgacggagcacgtcgagatgcc
gacggatatttctgggtgatggggcgtgtggatgatgtcatcaacgtctcaggccatcgt
cttggcacgatggagatcgagtcggccttggtgagccatcccgccgtagcggaagcggct
gtggtcggacgacccgatgatctcaagggtgaggggattgttgccttcgtcacgctggag
ctgggacgagagtccaacgacgccctcgttgccgagctgcgcacccatgtcggcaaggag
atcgggccgatcgcaagacccgacgagattcgctgcagcgatgccttgccaaaaacgcgc
agtggcaagatcatgcgccggattctgagagcgcttgctgccggcgaagaagtaactggc
gacaccagcactcttgaagaccgctccgttcttgatcgtttacgcggataa

DBGET integrated database retrieval system