KEGG   Synechococcus sp. CC9311: sync_1627Help
Entry
sync_1627         CDS       T00390                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syg  Synechococcus sp. CC9311
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:syg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1491047..1491706
Genome map
AA seq 219 aa AA seqDB search
MIGWLRGERIEHWSQGGRQGLVIACAGVGYEVQLASRYLQPLSAGATCTVWIHQVQRDDG
SSLFGFPDRRERDLFRVLISVNGIGPQVGLALLESCSAAELIEAIIDGDLRRLTQAQGVG
KRTAERLAVELRDRLGAWSAEKNSDHSDLSLVDRSDLKSLPIEPDPLQDLQLTLSTLGYE
DLEIRRAMRAVATGEEVPAANDGDGWLRASLRWLNRPSA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctggctgcgaggagaacgaatcgaacactggagtcagggtgggcgtcaggga
ttagtcattgcttgcgctggagtggggtatgaggttcaacttgcctcgaggtatttgcaa
cctctctccgcaggcgcaacttgcaccgtctggattcatcaggttcaaagggacgatgga
tcgagtttgtttggctttccggatcgaagggaaagggacctgtttcgcgttttaatcagc
gtgaatggtattggtcctcaggtgggactggcattgttggagagctgcagcgctgcagag
ttgatcgaagcgatcattgatggggacctgcgtcgcctcacccaagcgcagggagtcgga
aaacgaacagcagaacgtcttgcagtcgaacttcgcgatcgtctgggggcttggagtgca
gagaagaacagtgatcattctgacctctcccttgtggacaggagtgatctcaaatcgctg
ccgattgaacccgacccactgcaagatttacagctcaccctcagcacactggggtatgaa
gatttagagatccgtcgcgcaatgcgtgcagttgccaccggggaagaggtcccggcagcc
aatgacggggatgggtggttacgcgccagtctgcgttggttgaaccgcccttcagcgtaa

DBGET integrated database retrieval system