KEGG   Synechococcus sp. CC9311: sync_1854Help
Entry
sync_1854         CDS       T00390                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
syg  Synechococcus sp. CC9311
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    sync_1854
Enzymes [BR:syg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     sync_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1651736..1652557
Genome map
AA seq 273 aa AA seqDB search
MASLHADLTLAVVGHLEWVNFLAVNALPAPGQISRAHRSLEEPAGAGAVVAVQLARLTGQ
RVAFFTALGKDEIGERSEARLLELGVIPIVAWRDQPTRRGISLVDHSSDRAITVIGERLT
PVANDPLPWEHLADCDGVFVSATDPQGLRLARAAKVLTATPRLRLPVLQEAGVSLDALIG
SNLDPAESIEEDALTPAPTLRIATEGEKGGILIPGGRFEAQPLPGLLAETYGCGDSFAAG
VTAGLAAGFAITDAIKLGAQCGATCATHFGPYA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacttcacgctgatctcactcttgctgttgttggacacctcgaatgggttaat
ttccttgccgttaatgcgttgcctgcgcctgggcagatcagccgtgcccatcgctcgcta
gaagagccagctggagccggagctgtcgtggctgttcaactggccaggcttacagggcaa
agagtggccttcttcacggcactcgggaaggatgaaatcggcgagcgaagcgaagcccgc
ctgcttgagttgggtgtcataccaatcgttgcctggcgtgaccaacccaccagacgcgga
atcagcttggttgatcacagcagcgatcgggcgatcacagtgatcggagagcgactaacg
ccggtcgccaatgatccattgccctgggagcatctcgccgattgcgatggggtgttcgtc
tcagcaaccgatccgcaggggctaaggctggcacgagcagccaaagttctaacggcaacg
ccacgccttcgtttaccggttcttcaagaggcaggtgtcagtctcgatgccttgatcggc
agcaatttggatccagcagagtccatcgaagaggatgcactcaccccagcgccaaccttg
cggatcgccacggaaggagagaagggagggattctcattccaggtggtcgatttgaagcc
caacctctccctggcctcctcgcagaaacctacggatgcggcgacagctttgcagctgga
gtaacagccggactcgctgcaggatttgccatcactgacgcgatcaagcttggagcccag
tgcggagcgacctgtgcaacacactttggtccttacgcctga

DBGET integrated database retrieval system