KEGG   Synechococcus sp. CC9311: sync_1864Help
Entry
sync_1864         CDS       T00390                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
syg  Synechococcus sp. CC9311
Brite
Enzymes [BR:syg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     sync_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1660865..1661539
Genome map
AA seq 224 aa AA seqDB search
MLSSFAKLPFAVLPAFRQARGIGVVSVGLLLGLGQGIHAERSSERLDQAEQVASALLQDV
KTDHKASPYSITPERRALLNTIRFAEGTWKDGHDLGYRTLYGGGQFEDLSKHPEKVVVKR
YVSAAAGAYQFLPTTWEEVSGRLSLPSFSPEHQDQAALHLVKRRGALKEVDQKGLTAEAM
NSLAPEWASFPTHSGRSAYGQPVKSHAELASFYSKNLQKLRQGA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgctgagctccttcgccaagctgcccttcgccgtcttacccgctttccgtcaagcaaga
ggcattggtgttgtcagcgtggggctgcttctaggccttggacaaggcattcatgccgag
cgctccagcgaaagacttgatcaagcagagcaagtggcatcagcccttctgcaagacgtc
aaaacggaccacaaagcttccccctattcaatcactccagaacgacgcgccctgctaaac
accattcgctttgcagaaggaacttggaaggatgggcacgatcttggctatcgcactctt
tatggaggcggccagtttgaagatctctcaaaacacccagagaaggtggtcgttaagcgt
tacgtcagtgccgctgcaggggcttatcaatttttgcccaccacttgggaagaagtttca
ggacgtttgagcttgcccagtttctctccagaacatcaagaccaagcggctcttcatcta
gtcaaaagacgcggagctctcaaagaggtagaccaaaaaggattaacagccgaagcgatg
aatagcctcgcccctgaatgggcatcttttcccacccattcaggacgcagtgcctacggt
cagcccgtcaaaagccatgctgagctagcaagtttctattcaaaaaatcttcagaagctt
cgtcaaggcgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system