KEGG   Synechococcus sp. CC9311: sync_1868Help
Entry
sync_1868         CDS       T00390                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sync_1868 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_1868 (glk)
   00052 Galactose metabolism
    sync_1868 (glk)
   00500 Starch and sucrose metabolism
    sync_1868 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    sync_1868 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sync_1868 (glk)
   00524 Butirosin and neomycin biosynthesis
    sync_1868 (glk)
Enzymes [BR:syg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     sync_1868 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1664206..1665279
Genome map
AA seq 357 aa AA seqDB search
MQPTTYLAGDLGGTKTLLAIYSDQNGELKQEHVQRYVSAEWTSLDSMLNHFLQARPDTNS
TPQTSCFAVAGPVKNRAAELTNLGWTISQESLKQSAGLEQVELVNDFAVLIYGLPHFSDS
QQITLQAGSTKNSENTQSEPGPVAILGAGTGLGMARGLPSNKGWIALPSEGGHREFAPRS
DDEWGLVQWLKRDLSLERISVERVVSGTGLGHVMHWMLQQSKDAKHPLQEKAKAWRWNKP
DHPDYHDLPASTCQYAKAGDQLANAAMTLWLSAYGAAAGDLALQELCTGGLWIGGGTAEK
NQDGLKSIHFLNAMRQKGRFQPFLEGLTVRAVIDPEAGLFSAACRARELAESSGTLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaacgacttacctggccggggatctcggtggcaccaaaacgctcctagccatc
tacagcgatcaaaatggcgagctgaaacaagagcatgtccagcgttacgtgtcggcggaa
tggacgtctctggactccatgctcaatcacttcctgcaagcacgcccagacaccaactcc
actcctcaaaccagctgcttcgccgtcgctggcccggttaagaaccgtgctgctgaactt
actaatttgggatggacgattagccaagagtcgctgaaacaatcggctggtttagagcag
gtggaactcgttaacgattttgctgttctgatctacggccttccccatttcagcgatagc
cagcagatcacgcttcaagctggatctacaaagaattctgaaaacacccaatccgagcca
ggccccgtcgccattcttggagcgggaacgggcttgggaatggctcgggggcttccgagc
aataagggatggattgccttacccagcgaggggggacatcgagagttcgcgccccgatcc
gacgacgaatggggccttgttcaatggctcaagcgcgatttgtctctagagaggatttct
gtggagagggttgtgagcggaaccggattgggccatgtcatgcactggatgctgcagcag
tcgaaagatgcaaagcacccgcttcaagagaaggccaaagcatggagatggaacaaacca
gatcaccctgattatcacgatctccctgcttcaacatgccaatacgccaaagcaggcgac
cagctcgcgaacgctgcaatgacgctttggcttagtgcttacggcgcagccgcaggagat
cttgccctacaggaactgtgcacgggtgggctctggattggtgggggcacggccgaaaaa
aaccaggatggattgaagtcgattcattttttaaacgccatgcgtcaaaaggggcgcttt
cagccgtttttggaaggtttgacggtgcgcgctgtgatcgatccggaagctggtctgttt
agtgctgcttgcagagcacgagaactggctgagtcgagtgggacactggcctga

DBGET integrated database retrieval system