KEGG   Synechococcus sp. CC9311: sync_1879Help
Entry
sync_1879         CDS       T00390                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syg00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:syg00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syg00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syg00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syg00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1676208..1677101)
Genome map
AA seq 297 aa AA seqDB search
MINSPEVIGIDLGGTAIKLGRFSADGCLLETQQVQTPQPATPGAVCIALVEAIEALDPDR
RALIVGIGLPGPMDVGARVARVCINLPGWEDIPLADWLESRLQRRVTLANDGNCALVGEA
WQGAAMGYSDVVMLTLGTGVGGGVMLSGRLFTGHNGAAAEPGLIGLDPNGPPCNSGNQGS
LEQFACISALRRLWDGDPAALATLAANGDGEAQAVWSRYGTTLGVGISSLVYMFTPELVL
VGGGISGAASHFLPSVRKEVERRVQAVSRQGLQIEACALGNGAGRLGAARLAIERLT
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgataaattcccctgaggtcatcggaatcgatttgggtggaacggcgatcaagcttggt
cgcttttcggccgatggttgccttcttgagacacagcaggtgcagactcctcagcctgct
actccaggtgcggtttgcattgctttggtagaggcgattgaagctttagatcccgatcgc
cgagccttgatcgttgggattggtttaccgggtccaatggatgtgggggctcgtgtagcc
agggtttgcatcaacctgcctggctgggaggacattcctctcgctgattggctggagtct
cgtcttcaacgtcgggtcaccctcgccaacgatggcaactgtgccttggtcggagaggca
tggcagggagcggccatgggttattccgatgtggtgatgctcactctcggcacgggtgtg
ggtggcggcgtgatgctgtctggccgtttattcaccggtcacaatggggccgcggctgaa
ccggggctgattggtctcgatcccaacggcccaccctgcaacagcggtaatcagggcagt
ctcgaacagttcgcctgtatttctgctttgaggcggctgtgggatggagacccagcggca
ttggcaactttggctgcaaatggcgatggggaagcccaagcagtgtggtcccgttatggg
accacacttggcgtaggaatcagctcgttggtgtacatgttcacgccagagctggtcctc
gtgggtggtggaatttcaggagcggcgtcccattttctgccttctgttcgtaaggaagtt
gaacgacgggtgcaggccgtgagtcgtcaaggtctgcagattgaagcctgtgccctagga
aacggtgcaggccgtcttggggctgcccgactggccatcgaacgcttgacgtaa

DBGET integrated database retrieval system