KEGG   Synechococcus sp. CC9311: sync_2087Help
Entry
sync_2087         CDS       T00390                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syg  Synechococcus sp. CC9311
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:syg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1848301..1849218
Genome map
AA seq 305 aa AA seqDB search
MMPSSPTLLAGINLQDVLKVLRPLSWGAADILRAYARGEQPPHGFSKALSVDNGGEGPVS
AADLAVNQWLLDGLKQSFPTADWTLLSEETAKEQLTEGQPLAAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVHQQRPVLGVVLVPEREELWIGVVGDGTWCENRSGERTPVRFSERKATN
QLTLVASRSHRDQRLEQLITALELGDSHAVGSVGCKVATILRGETDLYISLSGKSAPKDW
DMAAPEAVLLAAGGAFTHADGRELIYNTGDVRQAGCLIASHGKAHATLCRKAAQAMGLID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgagctcgccaacccttcttgccggtatcaacctgcaagatgttttaaaggtt
cttcgccctctcagctggggagccgcagacatcctgcgcgcctatgcccgtggagaacag
ccacctcacggtttttcgaaggccctgagcgttgacaacggaggcgaaggtccagtttcc
gcagctgatctagcggttaatcaatggctcctggatggcttgaaacaatccttccccacc
gctgattggactcttctcagtgaagaaaccgccaaagagcaactaacggaagggcaaccc
ttggctgctgagtggttatggattttggatccactcgatggcaccaaagatttcctgcaa
ggcacaggcgaatacgccgtgcatcttgcgttagtgcatcagcaacgaccggtccttggg
gtggtgctagtaccagagcgagaagagctttggattggtgtggtgggtgacggcacctgg
tgcgagaaccgctcaggagaacgcacgccagttcgtttcagtgagcgaaaggccaccaac
caactcaccttggtggcaagccgcagtcacagagatcagcgacttgaacagttgatcacc
gccctagaactcggggattcccatgcggtgggcagtgttggctgcaaagtggccacgatc
cttcgcggcgaaaccgatttgtacatctccctgtctgggaaaagtgctccgaaagattgg
gatatggccgctccagaagccgtactactcgcagctggtggtgccttcacccatgcagat
ggcagagagctcatctacaacaccggcgatgttcgccaggccggctgtttgatcgctagc
catggaaaagcccatgccactttgtgtaggaaagcggcacaggcgatgggattgatcgat
cccggttttcaggtttag

DBGET integrated database retrieval system