KEGG   Synechococcus sp. CC9311: sync_2087Help
Entry
sync_2087         CDS       T00390                                 

Definition
(GenBank) CysQ protein homolog
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00920  Sulfur metabolism
syg01100  Metabolic pathways
syg01120  Microbial metabolism in diverse environments
syg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    sync_2087
Enzymes [BR:syg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     sync_2087
Transfer RNA biogenesis [BR:syg03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    sync_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: ABI46610
CyanoBase: sync_2087
CYORF: sync_2087
UniProt: Q0I8D3
Position
1848301..1849218
Genome map
AA seq 305 aa AA seqDB search
MMPSSPTLLAGINLQDVLKVLRPLSWGAADILRAYARGEQPPHGFSKALSVDNGGEGPVS
AADLAVNQWLLDGLKQSFPTADWTLLSEETAKEQLTEGQPLAAEWLWILDPLDGTKDFLQ
GTGEYAVHLALVHQQRPVLGVVLVPEREELWIGVVGDGTWCENRSGERTPVRFSERKATN
QLTLVASRSHRDQRLEQLITALELGDSHAVGSVGCKVATILRGETDLYISLSGKSAPKDW
DMAAPEAVLLAAGGAFTHADGRELIYNTGDVRQAGCLIASHGKAHATLCRKAAQAMGLID
PGFQV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgagctcgccaacccttcttgccggtatcaacctgcaagatgttttaaaggtt
cttcgccctctcagctggggagccgcagacatcctgcgcgcctatgcccgtggagaacag
ccacctcacggtttttcgaaggccctgagcgttgacaacggaggcgaaggtccagtttcc
gcagctgatctagcggttaatcaatggctcctggatggcttgaaacaatccttccccacc
gctgattggactcttctcagtgaagaaaccgccaaagagcaactaacggaagggcaaccc
ttggctgctgagtggttatggattttggatccactcgatggcaccaaagatttcctgcaa
ggcacaggcgaatacgccgtgcatcttgcgttagtgcatcagcaacgaccggtccttggg
gtggtgctagtaccagagcgagaagagctttggattggtgtggtgggtgacggcacctgg
tgcgagaaccgctcaggagaacgcacgccagttcgtttcagtgagcgaaaggccaccaac
caactcaccttggtggcaagccgcagtcacagagatcagcgacttgaacagttgatcacc
gccctagaactcggggattcccatgcggtgggcagtgttggctgcaaagtggccacgatc
cttcgcggcgaaaccgatttgtacatctccctgtctgggaaaagtgctccgaaagattgg
gatatggccgctccagaagccgtactactcgcagctggtggtgccttcacccatgcagat
ggcagagagctcatctacaacaccggcgatgttcgccaggccggctgtttgatcgctagc
catggaaaagcccatgccactttgtgtaggaaagcggcacaggcgatgggattgatcgat
cccggttttcaggtttag

DBGET integrated database retrieval system