KEGG   Synechococcus sp. CC9311: sync_2362Help
Entry
sync_2362         CDS       T00390                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syg  Synechococcus sp. CC9311
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:syg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2073811..2075094
Genome map
AA seq 427 aa AA seqDB search
MRCISTAAQAEQELDRIATRTTGATQREAELRVQEILEQVKREGDQALISLTEKFDGFRP
EPLRIDPGLLEQAWNDTPANLRDALDLAHRRIQDFHQRQRPSDLSVSGVHGEQIGRRWRP
VHAAGLYIPGGRAAYPSTVLMNAVPAKAAGVKRIAMVTPAGANGLINTTVLAAAHIAGIR
EVYRVGGAQAIAALAYGTETVQKVDVISGPGNLFVTLAKKSVYGQVGIDSLAGPSEVLVI
ADQTAKPEQVAADLLAQAEHDPLAAAILLTTEEELSRSVPEEIERQLASHPRESICRQSL
SQWGLIVTCDSLEKCANLSDRFAPEHLELLVERPRMMADRINHAGAIFIGPWSPEAVGDY
LAGPNHTLPTCGAARFSGALSVETFMSHTSLIEFNKEALDATGVAVETLAMSEGLHSHAN
SVRIRLQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcatcagcaccgcagcgcaagctgaacaagaactcgatcggatcgcaacaaga
acaacaggagcgacccagagagaagcggagcttcgggtccaagaaattttggagcaggtc
aaaagagagggagatcaagctcttattagcctcacagagaaatttgatggcttccgccca
gaacctcttcgcatcgatccaggtctgctggagcaagcctggaatgacacgcctgccaac
cttcgtgatgccttagatctcgcgcaccgacgcatccaagactttcaccagcggcaacgt
ccctctgacctcagcgtttctggtgttcacggagagcaaatcggtcggcgctggcgccca
gtccatgcagcaggcctttacatcccagggggcagagctgcataccccagcacagtttta
atgaatgccgtgcctgcaaaggctgcaggcgtgaagcgaatcgcgatggtcacccctgct
ggtgccaacggattgatcaacaccactgttcttgcagccgctcacattgctgggatccgg
gaggtgtatcgggtcggcggtgcacaagcaatcgcggcgctggcctacggaacagaaacc
gtccagaaggttgatgtcatcagtggaccaggaaatcttttcgtgactttggccaaaaag
tcggtctatggccaggtagggattgattctctggcaggtccaagtgaagtcttggtgatc
gccgaccaaacggccaaaccagagcaggtggcggccgacctgctagctcaggcagaacat
gacccattggcagctgccatcctgctcacaactgaagaggagctctctcgatccgtccct
gaggagattgaacgccagctggcgtcccatccacgcgagagcatttgccggcaatcctta
agccaatgggggctgatcgtgacttgcgacagccttgaaaagtgcgcaaatctcagcgat
cgcttcgccccagagcacttggaactccttgtcgagcgaccaagaatgatggctgaccgc
atcaaccacgcaggtgccatttttattggcccatggagtccagaagctgtcggagactac
ttagctggtcctaaccacacactccccacctgcggcgccgctcggtttagcggtgccctc
agcgtggagacgtttatgagtcacacttcgctcatcgagttcaacaaggaagctcttgat
gcaacaggggttgctgtggagaccttggccatgagcgaaggactccacagtcatgccaat
tcggtacggatccgtcttcagtaa

DBGET integrated database retrieval system