KEGG   Synechococcus sp. CC9311: sync_2475Help
Entry
sync_2475         CDS       T00390                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
syg  Synechococcus sp. CC9311
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    sync_2475 (fucA)
Enzymes [BR:syg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     sync_2475 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2166380..2167048)
Genome map
AA seq 222 aa AA seqDB search
MNDRGLRCELVDVARAMNSTGLNQGTSGNLSLRIEGGLLVTPSSLAYDQMEPEDLVAIDF
CGQPLQTGLSGDKRRPSSEWRLHADVLADRPDAMAVFHCHPIHATALACHDRGIPPFHYM
TAVAGGDDIRCAPYATFGTEALSAHTVQALQNRQACLLAHHGLVSLGRDLDQALKIAIEV
ETLAQMYLQALQLGEPPLLSAAQMEEVHRQFRGLGYGQASKD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgagggttgcgttgcgagctggtggacgtggcccgtgcgatgaacagcact
ggtttgaatcagggcacatcaggcaacctgtcgttgcggattgagggggggttgttggtg
acccccagctccttggcctacgaccagatggagccggaggatctggtggcgatcgatttt
tgcggccaacctttgcaaacagggttgtctggcgacaaacggagaccctcttcggagtgg
cgcctgcatgccgatgtcttagctgatcggcccgatgccatggcggtgtttcattgccat
cccattcatgcaactgcgcttgcatgccatgaccgcggcattccaccgttccactacatg
accgcggtggctggtggtgatgacattcgctgtgctccctatgcgaccttcggcaccgag
gcgctatcggcccatacggtgcaggccctgcagaacaggcaggcctgtttgctggctcac
cacggattggtcagtttgggtcgagatcttgatcaggcgctgaagattgccattgaggtg
gagacgctggcacagatgtatttacaagctcttcagctgggggagcccccgcttttgtcg
gcagcacaaatggaagaggtgcatcgtcagtttcgcgggttgggatatggccaagcctct
aaagattga

DBGET integrated database retrieval system