KEGG   Synechococcus sp. CC9311: sync_2563Help
Entry
sync_2563         CDS       T00390                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
syg  Synechococcus sp. CC9311
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    sync_2563
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    sync_2563
Enzymes [BR:syg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     sync_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2245766..2247424
Genome map
AA seq 552 aa AA seqDB search
MNADELRQAVARLLVVRASGHATDRQRRYPRWELSNHELEQLLRAGVGGVILLGGTSTEL
QQRCRTFQRWAGQPILLCADVEEGVGQRFEGASWLVPPMALGRLHRKDPKQALQLAEQYG
RCCGNQAKRCGLNWVLAPVCDVNSNPNNPVINVRAWGEDPHTVGELTGAFQRGLAATGVL
GCAKHFPGHGDTATDSHLELPLLPHSRERLNSLELQPFRTLIQEGVSSVMTAHLLIPTLD
AQWPATLSAKVLTTLLRVDLGFKGLVVTDALVMEAIAARYGAGEAAVLAFAAGADLILMP
ADAVKAIDALCDALCSGRVPMARLHDSLDRRQAALQSIPLMLDSSDNDQTIETTEERAFT
LELVTKTLEISNCLNANGSIQDEASTQATPINGINLIRVDGVLPCPVLPANAPAILLPKA
LGFHSVLSHPLGISPWADPADPLAPLALDRLGNGPLLLQLFVRGNPFQANRSMREPWTDA
IKQLIDLNRLFGLVVYGSPYVWEALNALLPRSIPAAYSPGQMPDAQQQLLQRVLIPDPSS
APSTMGINEFTD
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggacgagcttcgtcaggccgtcgcacgattgttggtggtgcgcgccagcggt
catgccacagaccggcaaaggcgatacccgcgctgggagctaagcaatcacgagctagag
cagctgttaagagctggggtcgggggggtgatccttctcggaggaacatcaacagaattg
caacagcgctgccgcacatttcaacgctgggctgggcaaccaatcctgttatgcgctgac
gttgaagaaggcgttggccaacgctttgagggggccagttggctcgtaccaccgatggcg
ctcggacggctccatcggaaagatccgaaacaggccttgcagcttgcggaacaatacgga
cgttgttgcggcaatcaggcgaagcgctgcgggctgaattgggtgctggctccggtttgc
gatgtgaacagcaaccccaataacccggtcatcaacgtgcgggcctggggagaagatcca
cacaccgtgggggagttaacaggagcctttcagcgtggattggccgctacaggtgtcttg
ggctgcgccaagcatttccctggccatggcgacaccgccaccgactcccacctggaactt
cctctgctgccacacagtcgcgaacgcttaaacagccttgaacttcaaccatttcgcacc
ctgatccaggagggagtcagcagtgtgatgacagcccatctattaattccaacgttggat
gcacagtggcccgccactctctccgccaaggtgctcaccacacttttaagggttgatctt
ggcttcaagggccttgttgtcaccgatgccttggtgatggaggcgattgcggcacgctac
ggggcaggagaagccgcagtgctggcattcgccgcaggtgctgacctgatcttgatgccg
gccgatgcagtgaaggccatcgacgccctctgtgatgcgctgtgttcgggccgtgtgccc
atggccaggctgcatgactccctagatcgccgccaggctgccttgcagtccatcccgctg
atgctggattcgagcgacaacgaccagacgatcgaaacaacagaggaaagagctttcact
ttggagctcgtgacaaagacgctggagatctccaactgtttaaacgcgaacggttcaatc
caggacgaagcatcaacccaagccacgcccattaatggcatcaatttgatccgagtcgat
ggtgttcttccctgcccggttcttcccgccaatgcccctgcaatccttcttcccaaggcc
ctcggattccactctgtactgagtcatccccttggcatttctccgtgggcggatcccgca
gaccctttggccccgctggcgctcgatcgcctcgggaacggaccgctgctgctgcaatta
tttgtgcgtggcaatccatttcaagccaaccgcagcatgcgggagccctggactgatgcc
atcaaacaactgattgacttgaaccgactatttggcttggtggtctatggaagcccctac
gtctgggaggccctgaatgcactgctgccgaggtcaattccagcggcttacagcccgggg
caaatgcctgacgcgcagcaacagttgcttcagcgtgtcttgattcctgatccatcttca
gctccatcaacgatgggcatcaatgaattcaccgactga

DBGET integrated database retrieval system