KEGG   Synechococcus sp. CC9311: sync_2633Help
Entry
sync_2633         CDS       T00390                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sync_2633 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sync_2633 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sync_2633 (trpB)
Enzymes [BR:syg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     sync_2633 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2309675..2310931)
Genome map
AA seq 418 aa AA seqDB search
MTSTLPTANTPDPASLMPSVRPEAHGRYGRYGGQYVPETLMPALAELEQAAAEAWKDSAF
TTELNRLLKSYVGRATPLYEAERLSAHYRRSDGGPRIWLKREDLNHTGAHKINNALGQAL
LALRMGKKRIIAETGAGQHGVATATVCARFGLECVVYMGAEDMRRQALNVFRMRLLGATV
QAVTAGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGNEAREQC
KESFGRLPDVLLACVGGGSNAMGLFHPFVQDTSVRLIGVEAAGDGVATGRHAATITEGRV
GVLHGAMSLLLQDQDGQVQEAHSISAGLDYPGVGPEHSYLRDIGRAEYGAVTDDEAITAL
RLVSELEGIIPALETAHAFAWLEMLCPTLPNGSEIVINCSGRGDKDVNTVAEKLGNQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcactctgccgactgcaaacacacccgatcccgccagcctgatgccttcggtt
cgacctgaagcacatggccggtacggacgttatggaggtcagtacgttcctgaaacgttg
atgccagcgctggcggagcttgagcaagcggccgctgaggcttggaaggattcagccttc
acaactgagctgaaccggttgttgaaatcgtatgtaggtcgtgcgactcctctttacgaa
gcggagcgtctgtcggctcattatcggcgttccgatggtggcccacgcatctggttgaag
cgggaagatctcaaccacacgggtgcgcacaaaatcaacaatgcccttggtcaggcgttg
ttggccttgcgcatgggcaagaagcggatcattgcggaaaccggtgcgggtcagcatggc
gttgctacagcgacggtctgcgcacgtttcggtctggagtgtgtcgtttacatgggcgct
gaagacatgcgtcgccaggcgctgaatgtgttccgaatgcgcttactgggagccaccgtt
caggcggtaacggcagggacggccaccttgaaagacgccacgagcgaagccatccgcgat
tgggtgaccaatgtggaaaccacccactacatccttggatctgtggcaggcccgcatccc
tatcccatgttggtgcgtgacttccatgcggtcattggcaatgaagcccgtgagcaatgt
aaggagtcctttgggcgtctccctgatgttttgttggcttgtgtgggtggaggttccaat
gcgatgggtcttttccatccattcgttcaagacacctctgttcgcctgataggagttgaa
gctgctggtgatggagtggcaaccggacgtcatgcggccacgattaccgagggtcgcgtg
ggtgtgctgcacggagcgatgagcctgctgcttcaagatcaggacggtcaggtgcaggaa
gcgcactccatcagtgctgggcttgattaccccggggtggggccagagcacagttatctg
cgggacattggccgcgcggaatacggtgctgtgaccgacgatgaggcgatcacagcttta
cggcttgtgagtgagttggagggaatcattcctgcgttggaaacagcccatgcgtttgct
tggctggaaatgttgtgcccaacgcttccaaacggcagtgaaatagtgattaattgttct
ggtcgtggagataaagatgtgaacaccgtggcagaaaaactcggaaatcaactttga

DBGET integrated database retrieval system