KEGG   Synechococcus sp. CC9311: sync_2705Help
Entry
sync_2705         CDS       T00390                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
syg  Synechococcus sp. CC9311
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2376855..2378333
Genome map
AA seq 492 aa AA seqDB search
MTGKDWGERIPAGKSVTIGFNGTQGTEIGNEGELSAALLFGTDNAISTISPSNEESPGNA
DAPSEPVAEPIVETPPMTPPMTSPMESAMTPAMGEHGLGDHGMNHDHSMQQASESGFTDI
NIWGSFHDSNHNSEHNELVGGRTAITTEALLAYNGLRDFAGLAPVDIEAIGAWAFENKLT
NNSQAWGNDLQGVGLWFAMQGAKVGWIADASYDPQILADIQRTARLGSSGDVMQMVEQFG
HEGFADYLTTNQLEEHFINTLKMEPHYGGWMHARTHGFLSIEGVAIAHDIHHLTVLGWDQ
NEPFMNDTFDWPQWPALDVSDNTVINYYQGIVELGDPLSKNLENLSGTTPLISSTDSKPS
LNPSPSDPGTVQPDPLTGSPLEIQVSGDLWEGGFTVSMNVTNQSNQSLDDWGVSFISTHQ
FYGESWGVDVSTQELGDGLYRYELKGADWAQSLAAGQAMTVGFNALSGEELSGDGSLTSE
LLMASGTELTLL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggaaaagactggggagaacggatcccagcaggaaagtcggtcaccattggattc
aatgggacgcaaggcactgagataggaaacgaaggggagctttctgctgcattgctcttc
ggcacagacaacgcgatatcaacgatctcaccatcaaacgaagaaagccctgggaatgca
gacgccccttcggagccggtggctgaaccaatcgttgagacacctccgatgacacctccg
atgacgtcaccgatggagtcggcaatgacgccagcaatgggagaacacggcttgggagat
cacgggatgaaccatgaccactccatgcagcaagcgtccgaaagtgggttcacagacatc
aacatttggggctcttttcatgactccaatcacaactcagagcacaacgaacttgtcggt
ggacgaactgcaattacaacggaagcgttattggcttacaacggcttaagggactttgca
ggattagccccagttgatatcgaggccattggcgcatgggcttttgaaaataagctcaca
aataacagccaggcctggggtaacgatcttcaaggcgttgggctttggtttgcaatgcag
ggagccaaggtgggttggatcgccgatgcgtcctacgacccacaaatcctggccgacatt
caacgcacggcccgcctaggcagcagtggcgacgttatgcagatggttgaacagtttggc
catgaagggtttgctgattatttaacaaccaatcaactcgaagaacatttcatcaacacc
ctcaagatggagccgcattatggcggctggatgcacgccagaacccatggatttcttagc
atcgaaggcgtagccattgcacacgatattcatcatttaacagttttgggatgggatcaa
aatgaaccctttatgaatgacacctttgactggcctcagtggccggccctcgatgtcagc
gacaacactgtgatcaactattaccaaggcattgttgagctgggagatccactctcaaag
aacctagaaaatctttctggaaccacaccactgattagctcaaccgattcaaagccttca
cttaacccctcaccctctgatcccggaactgtgcaaccggatcctctcaccggctctccc
ctggagattcaggtgagtggtgatctttgggagggtggcttcaccgtctcgatgaacgtg
accaatcaaagcaatcaatcattggacgattggggggtgagtttcatcagcactcatcag
ttttacggagaatcctggggggtagatgtctccacgcaagagcttggagacggcctttac
cgctacgagctcaaaggtgctgactgggcacaatcgcttgctgcaggtcaagccatgacg
gtgggtttcaatgcattgagtggagaggaactcagcggggatggatctcttacatccgaa
ctgctgatggcctcaggaacggagctgacgctcctctaa

DBGET integrated database retrieval system