KEGG   Synechococcus sp. CC9311: sync_2791Help
Entry
sync_2791         CDS       T00390                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:syg01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:syg01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2457075..2457986
Genome map
AA seq 303 aa AA seqDB search
MVTSTPADASTQRELRIRAAVMAPRQMLPSHQRRLKGGTTSFMVVIHVLATVALLPRFWS
WQGLVAFGVLYWTTVLGVTLGLHRLVAHRSFEVPGWLERVLVVMGTLACQSGPIDWVALH
RHHHRFSDQPNDHHDAGRGLWWSHSEWMLHDIPALKEKHRYAGDLLSDRFYVWLDRWFLV
LQIPLGLALYWYGETAGVHGGGVGLVLWAIPLRLAVVYHVTWLVNSATHAFGYRNFNSPD
LSRNCWWVAVLSFGEGWHNNHHAYPNSARHGLRWFEFDITWMHIRLLRRLGLTRKVRQAR
YIG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggtcacatccaccccggctgacgccagcacccaacgcgagttgcgcattcgcgcagcc
gtgatggcaccgcgtcagatgcttccctcacaccagcgccgccttaaaggggggaccacc
agcttcatggttgtcatccacgtgctggcaacggtggccttacttccacgcttttggagc
tggcagggtctggttgccttcggcgttttgtattggacgaccgtgctgggcgtaaccctg
ggtctgcatcggctggtggcgcaccgcagctttgaagtgcccggctggcttgagcgggtt
ctcgtggtgatgggcaccctggcctgccagagcggaccgatcgattgggtggcgttgcat
cgccaccatcaccgcttttcggatcaacccaatgatcaccacgatgcgggacggggattg
tggtggagtcacagcgagtggatgctccacgacatccctgcgttgaaagaaaagcatcgc
tatgcgggcgatctgctgagtgatcgtttctatgtatggcttgaccgctggttccttgtg
ctccaaatcccactggggttagctctgtattggtacggagaaacagcaggagtacacggt
ggaggagttggtctcgttctgtgggccatccccttacgtctcgccgttgtgtatcacgtg
acttggttggtgaattccgccactcacgcctttggctacaggaatttcaacagtcctgat
ctttcacgtaactgctggtgggtggccgtgctgtcctttggagagggctggcataacaac
caccatgcctatccaaatagcgcccgccacgggcttcgttggttcgaattcgacatcacg
tggatgcacattcgtctgcttcgcagacttggactcacgcgcaaagtgcgacaagcccgc
tacatcggctaa

DBGET integrated database retrieval system