KEGG   Synechococcus sp. CC9311: sync_2793Help
Entry
sync_2793         CDS       T00390                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:syg01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:syg01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2458778..2459710
Genome map
AA seq 310 aa AA seqDB search
MVSSTIRTPSPPSRPAASHLAVAQASLLRRPRKGEPATSPKNHQHSVTIGFMIVIHALAA
VALLPGFWSWPAVTSLLVLYWVTACLGVTLGYHRLLTHRSFRLPLWLERFFATCGALSCQ
HGPIDWVGLHRHHHKFSDTDADHHNSHRGFWWSHMGWMFHPIEAMPAVPRLTGDLLSDPY
YRWLNAHFLWLQLPLGLLLFWIGTATGAGGWALVMWGIPLRLVVVYHVTWLVNSATHCWG
NVVYDSGDASRNNKWVAALTFGEGWHNNHHAFPHSARHGMQPGQIDLTWEHIRLLRALGL
ATKVRLPVAS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaagcacgatcagaactccgtcgccgcccagtcggccggcagcttcgcacctg
gcagttgctcaagcaagccttcttcgtcgtccacgcaaaggcgagcctgcaaccagccct
aaaaatcaccaacattccgtcacgattggattcatgatcgtgatccacgcccttgcggct
gtggctcttctgcctggtttctggagctggcctgctgtgaccagcctgctggttctgtac
tgggttacagcctgccttggagtcacccttggctatcaccgcctactcacacaccgatcc
ttccgtctacccctttggctggaacgctttttcgcaacctgcggggccctgagctgccaa
cacggtccgatcgactgggtggggctgcatcgccatcaccataagttttccgatacggat
gcagatcaccacaacagccatcgcgggttctggtggagccacatgggttggatgttccac
ccgatcgaagccatgcctgcagtgcctcgcctcaccggcgatctcttgagcgatccctat
taccgctggctaaatgcccatttcctctggctccagctcccccttggcttgctgttgttc
tggatcggcacggccacaggtgctggcggttgggccttggtgatgtggggcattcctttg
cgcctggtggtcgtctatcacgtcacctggcttgtgaactcggccactcattgctggggc
aacgtcgtctatgacagcggtgacgcatcacgcaacaacaaatgggttgcggcgctcacc
ttcggcgagggctggcacaacaatcaccatgccttcccccactccgcacgccacggcatg
cagccaggtcagatcgatctcacctgggaacacatccgcctcttgcgcgcgttagggctc
gcaaccaaggtccgcctaccggtcgcgtcgtaa

DBGET integrated database retrieval system