KEGG   Synechococcus sp. CC9311: sync_2793Help
Entry
sync_2793         CDS       T00390                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    sync_2793
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    sync_2793
Enzymes [BR:syg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     sync_2793
Lipid biosynthesis proteins [BR:syg01004]
 Desaturase
  First
   sync_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2458778..2459710
Genome map
AA seq 310 aa AA seqDB search
MVSSTIRTPSPPSRPAASHLAVAQASLLRRPRKGEPATSPKNHQHSVTIGFMIVIHALAA
VALLPGFWSWPAVTSLLVLYWVTACLGVTLGYHRLLTHRSFRLPLWLERFFATCGALSCQ
HGPIDWVGLHRHHHKFSDTDADHHNSHRGFWWSHMGWMFHPIEAMPAVPRLTGDLLSDPY
YRWLNAHFLWLQLPLGLLLFWIGTATGAGGWALVMWGIPLRLVVVYHVTWLVNSATHCWG
NVVYDSGDASRNNKWVAALTFGEGWHNNHHAFPHSARHGMQPGQIDLTWEHIRLLRALGL
ATKVRLPVAS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaagcacgatcagaactccgtcgccgcccagtcggccggcagcttcgcacctg
gcagttgctcaagcaagccttcttcgtcgtccacgcaaaggcgagcctgcaaccagccct
aaaaatcaccaacattccgtcacgattggattcatgatcgtgatccacgcccttgcggct
gtggctcttctgcctggtttctggagctggcctgctgtgaccagcctgctggttctgtac
tgggttacagcctgccttggagtcacccttggctatcaccgcctactcacacaccgatcc
ttccgtctacccctttggctggaacgctttttcgcaacctgcggggccctgagctgccaa
cacggtccgatcgactgggtggggctgcatcgccatcaccataagttttccgatacggat
gcagatcaccacaacagccatcgcgggttctggtggagccacatgggttggatgttccac
ccgatcgaagccatgcctgcagtgcctcgcctcaccggcgatctcttgagcgatccctat
taccgctggctaaatgcccatttcctctggctccagctcccccttggcttgctgttgttc
tggatcggcacggccacaggtgctggcggttgggccttggtgatgtggggcattcctttg
cgcctggtggtcgtctatcacgtcacctggcttgtgaactcggccactcattgctggggc
aacgtcgtctatgacagcggtgacgcatcacgcaacaacaaatgggttgcggcgctcacc
ttcggcgagggctggcacaacaatcaccatgccttcccccactccgcacgccacggcatg
cagccaggtcagatcgatctcacctgggaacacatccgcctcttgcgcgcgttagggctc
gcaaccaaggtccgcctaccggtcgcgtcgtaa

DBGET integrated database retrieval system