KEGG   Synechococcus sp. CC9311: sync_2851Help
Entry
sync_2851         CDS       T00390                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syg  Synechococcus sp. CC9311
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:syg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2504310..2505188
Genome map
AA seq 292 aa AA seqDB search
MNNPKSQTIDQSLFDDEGAIFMGGQRDPEGCRIALFGVPYDGTTSFRPGTRFGPAAIREV
STGLETYCPQLDRDLEDIPYADIGAVEIPYGDPQPVVDAVRHATGTVLAAGMKPLMLGGE
HSISSGAVAAVAEQHPDLVLVQLDAHADLRNEWLGSRHSHACAMRRCLEVLPSQQLLQIA
IRSGTFEEFKELHRNERLISVQEIPERMTPLRGRPIYLTVDLDWFDPAVMPGTGTPEPGG
FIWNDFAAVINELRHHRLMGADVVELAPQLDSSGISSVLAAKVTRSLLLLMA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcccaaaagccaaacgattgatcagagcctgtttgatgacgaaggtgccatt
tttatgggaggacagcgagatccagagggatgccggatcgccttgtttggcgtgccctat
gacggcaccacctcgttccgaccaggcacccgatttggcccagccgcgattcgtgaagtg
agcacaggtcttgagacctactgcccccagctggatcgagacctcgaagacatcccttac
gccgacattggagccgttgagattccctatggcgacccacagcccgttgtggatgccgtg
cgccacgccactggcaccgtgctggctgcaggcatgaagccgctgatgcttggcggtgag
cattccatcagctctggtgcggttgctgctgtggcggagcaacaccccgacctcgtgctg
gtgcaactcgatgcccatgccgacttacggaatgagtggcttggatcccgtcacagccat
gcctgcgccatgcgccgctgtttggaggtgctgcctagccaacaacttttacagatcgcg
atccgcagcggcacctttgaagaattcaaagagctacatcgcaatgaaaggctgatctca
gttcaagagatccccgagcgaatgaccccactcaggggacggccgatctacctcaccgtg
gacctcgactggttcgacccggccgtaatgccggggacagggaccccagagccaggtggt
tttatttggaacgatttcgcagctgtgatcaacgagctgcgccaccatcgcctcatgggc
gcagatgtggtggagctcgctcctcaactcgattcaagtgggatcagtagcgtcttggcc
gccaaagtcacccgcagcctgctgctgttgatggcttag

DBGET integrated database retrieval system