KEGG   Synechococcus sp. CC9311: sync_2943Help
Entry
sync_2943         CDS       T00390                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00260  Glycine, serine and threonine metabolism
syg00750  Vitamin B6 metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
syg01230  Biosynthesis of amino acids
Module
syg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sync_2943 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    sync_2943 (thrC)
Enzymes [BR:syg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     sync_2943 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TPR_14 TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ABI46250
CyanoBase: sync_2943
CYORF: sync_2943
UniProt: Q0I5Z2
Position
2605439..2606497
Genome map
AA seq 352 aa AA seqDB search
MQDWPGLIEAYRSWLPVSSATPVITLHEGATPLIPVPSIAERIGRGVKVFIKYDGLNPTG
SFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRGGMRAFVLIPDGYVAQGKLA
QALVYGAEVLAIRGNFDRALDIVREAAEKYPITLVNSVNPYRLQGQKTAAFEIVDALGDA
PDWLCIPMGNAGNITAYWMGFQEYQQAGRSRRLPRMMGFQASGSAPLVNETTVSDPETIA
TAIRIGNPVNREKAIAARKASNGAFLDVTDEEIIDAYKLLGGQEGIFCEPASAASVAGLI
KRGAEVPDGSTVVCVLTGNGLKDPDCAINNNDAAFYADLDPDLTTVAKVMGF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactggccaggactgattgaagcctatcgatcctggcttcccgtttcctcagcc
actccagtgatcaccttgcacgaaggtgccactccgctcattcccgtcccatccattgcg
gaacgaattggccgcggcgtgaaagttttcatcaaatacgacggtttgaatcccaccgga
tccttcaaggatcgagggatgaccatggcgatcagcaaagccaaagaagcagggtgtgaa
gcggtgatttgtgccagcactggcaacaccagtgccgccgccgccgcctatgcccgtcga
ggcggaatgcgagccttcgtgttgattccagacggatacgtcgcacaaggaaaactggcg
caggccctggtctatggagctgaagtgctggcgatccgggggaatttcgaccgtgctctc
gacattgttcgagaagcagccgagaaatatccgatcaccttggtgaattcggtcaacccc
taccgactgcaagggcaaaaaactgcagcctttgaaatcgtcgatgccttaggagatgct
cccgactggctatgcatcccgatgggtaacgccggaaatatcacggcctactggatggga
ttccaggaatatcaacaagctggacgcagtcggcgtttaccgcgaatgatgggatttcag
gccagtggctccgcgccactggtgaatgaaaccaccgtgagcgatccagaaacaatcgct
actgcgattcgtatcgggaatccggtgaaccgagagaaggccatcgcagcccgtaaagcc
agcaacggagccttccttgatgtcaccgatgaagaaatcattgatgcctacaaacttctc
ggcggccaagaaggaatcttctgtgaacccgccagtgcagcctcagtggcgggcttaatc
aaacgtggagcagaggttccagacggatccacggtggtctgtgtgttgacaggcaatggc
ctgaaagatccggactgcgccatcaacaacaacgacgccgctttttacgccgatcttgat
ccggatctgaccaccgtggccaaggtgatgggcttctaa

DBGET integrated database retrieval system