KEGG   Synechococcus sp. CC9311: sync_2943Help
Entry
sync_2943         CDS       T00390                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syg  Synechococcus sp. CC9311
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sync_2943 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sync_2943 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    sync_2943 (thrC)
Enzymes [BR:syg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     sync_2943 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2605439..2606497
Genome map
AA seq 352 aa AA seqDB search
MQDWPGLIEAYRSWLPVSSATPVITLHEGATPLIPVPSIAERIGRGVKVFIKYDGLNPTG
SFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRGGMRAFVLIPDGYVAQGKLA
QALVYGAEVLAIRGNFDRALDIVREAAEKYPITLVNSVNPYRLQGQKTAAFEIVDALGDA
PDWLCIPMGNAGNITAYWMGFQEYQQAGRSRRLPRMMGFQASGSAPLVNETTVSDPETIA
TAIRIGNPVNREKAIAARKASNGAFLDVTDEEIIDAYKLLGGQEGIFCEPASAASVAGLI
KRGAEVPDGSTVVCVLTGNGLKDPDCAINNNDAAFYADLDPDLTTVAKVMGF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggactggccaggactgattgaagcctatcgatcctggcttcccgtttcctcagcc
actccagtgatcaccttgcacgaaggtgccactccgctcattcccgtcccatccattgcg
gaacgaattggccgcggcgtgaaagttttcatcaaatacgacggtttgaatcccaccgga
tccttcaaggatcgagggatgaccatggcgatcagcaaagccaaagaagcagggtgtgaa
gcggtgatttgtgccagcactggcaacaccagtgccgccgccgccgcctatgcccgtcga
ggcggaatgcgagccttcgtgttgattccagacggatacgtcgcacaaggaaaactggcg
caggccctggtctatggagctgaagtgctggcgatccgggggaatttcgaccgtgctctc
gacattgttcgagaagcagccgagaaatatccgatcaccttggtgaattcggtcaacccc
taccgactgcaagggcaaaaaactgcagcctttgaaatcgtcgatgccttaggagatgct
cccgactggctatgcatcccgatgggtaacgccggaaatatcacggcctactggatggga
ttccaggaatatcaacaagctggacgcagtcggcgtttaccgcgaatgatgggatttcag
gccagtggctccgcgccactggtgaatgaaaccaccgtgagcgatccagaaacaatcgct
actgcgattcgtatcgggaatccggtgaaccgagagaaggccatcgcagcccgtaaagcc
agcaacggagccttccttgatgtcaccgatgaagaaatcattgatgcctacaaacttctc
ggcggccaagaaggaatcttctgtgaacccgccagtgcagcctcagtggcgggcttaatc
aaacgtggagcagaggttccagacggatccacggtggtctgtgtgttgacaggcaatggc
ctgaaagatccggactgcgccatcaacaacaacgacgccgctttttacgccgatcttgat
ccggatctgaccaccgtggccaaggtgatgggcttctaa

DBGET integrated database retrieval system