KEGG   Synechocystis sp. PCC 6803: sll0005Help
Entry
sll0005           CDS       T00004                                 

Definition
ABC1-like
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2495493..2497538)
Genome map
AA seq 681 aa AA seqDB search
MSPAPMPVTTAEQDRDVVVIDAVVEEVRPPRLPKSHLEDLGPVSDMFPESWEYHPDLIME
FYRKRPLQVLGRLINILFPLLRFILGIWWEKLRGKDPTVSRAKAIQLRELLTNLGPTYIK
VGQALSTRPDLVPPVFLDELTTLQDQLPSFPNEVAYRFIEEELGAPAEEIYAELSPEPIA
AASLGQVYKGKLKTGEAVAVKVQRPDLVRRITLDIYIMRSLSLWARRSVKRLRSDLVAIT
DELASRVFEEMNYYQEAINGEKFAQLYGSLPEIYVPSIYWQYTGRRVLTMEWVEGIKLTN
IKAIQAQGIDATHLVEVGVQCSLRQLLEHGFFHADPHPGNLLAMADGRLAYLDFGMMSTI
QPYQRYGLIEAVVHLVNRDFDSLAKDYVKLDFLKPDTDLKPIIPALGQVFGNALGASVAE
LNFKSITDQMSAMMYEFPFRVPAYYALIIRSMVTLEGIAIGIDPNFKVLSKAYPYIAKRL
LTDQSEELRTSLKELLFKEGSFRWNRLENLLRNAKNSPGFDFDYVLNEATEFLLSDRGQF
IRDRLVAELVNSIDQLGRNTWQQVSHNIQERISFLGDLGNGNGKAHQTKTIKVVPQPAIA
QQEETWQHLQNLWQILKETPGFDPLKFVPVLSQIIVNPTSRRMGQQVAEGLLQKAIARVI
RQWALALESQPNPAIKIRNAA
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagcccccatgcccgttaccaccgccgaacaagatcgcgatgtagtggtgatc
gacgcagtggtggaggaagttcgccccccccgtttgcccaaaagtcatctggaggattta
ggacctgttagtgatatgttcccggaaagttgggaatatcacccagatttgatcatggag
ttttatcgcaagcggccgttacaagtattaggtcgtttaatcaatattttgtttccccta
ttgcgatttattctgggtatttggtgggaaaaattgaggggtaaagaccccaccgtttcc
agggcgaaagctattcaattaagagaactattaaccaatcttggccctacttatatcaaa
gttggccaagctctttccaccaggcccgatttagtgccgccggtctttttggatgagttg
acaacgttacaggaccaattaccttcctttcccaacgaggttgcctatcgttttattgaa
gaggagttgggggcccccgccgaggaaatttacgccgaattatctccggagcccattgcc
gccgcctccttggggcaggtgtataagggtaagttgaaaaccggcgaagctgtggcagtt
aaggtacaaaggccagatttggtgcgacgcatcacccttgatatttacatcatgcgctcc
ctctccctctgggcccggcgatcggtgaaaagattgcgctctgatttggtggccattacc
gacgaattggccagtcgagtattcgaggaaatgaactattaccaagaggccattaatggc
gaaaaattcgcccaactctatggcagtttgccagaaatttatgtgcccagtatctattgg
caatacactggccgacgggttttgaccatggagtgggtggaaggaattaagttaaccaat
atcaaagcgatccaagcccagggtattgatgctacccatttggtggaagtgggggtacag
tgctccctgcggcaattgttggaacatggctttttccacgccgatccccaccccggcaat
ttattggccatggcggacggccgtttggcctacttggacttcggcatgatgagtactatt
cagccttaccagcgctatggtttgatcgaggcagtggttcatttggtgaaccgggatttt
gattccctagctaaggattatgtcaaactggattttctcaaaccagatacggatttaaaa
ccgattattcccgcccttggtcaggtgtttggtaatgcgttgggggccagtgtggcggag
ttaaactttaagagcatcaccgatcaaatgtcggccatgatgtatgagtttcctttccgg
gtgccggcttattatgctctgattattcgttccatggtcaccctagaaggtattgccatt
ggtattgatcctaacttcaaggtattgagcaaagcctatccctatatcgctaaaagattg
ttaacggatcaatcagaagagctacgcacttccctgaaagaattactatttaaagagggg
agtttccgatggaatcgtttggaaaatttattgcgtaatgccaaaaattcccctggcttt
gattttgattatgtgcttaatgaagcaacagaatttttactttcagaccggggacaattc
attcgcgatcgcctggtggcggaattagtcaacagtattgatcaactggggcgcaacact
tggcaacaggtcagccacaatatccaggaaagaattagttttctgggtgacttaggtaat
ggcaacggtaaagcccatcaaaccaaaacgatcaaagttgtgcctcaacccgccatcgct
caacaggaggaaacttggcagcatttacaaaatctttggcaaattcttaaagagaccccc
ggttttgaccccctcaagtttgtgccggtgttgagtcaaattattgttaatcccacttcc
cgtcggatgggtcaacaggtggcggaaggactactgcaaaaggcgatcgccagggtaatc
cggcaatgggccctggctttggaaagtcagcccaatccagccatcaaaatccgcaatgca
gcctag

DBGET integrated database retrieval system