KEGG   Synechocystis sp. PCC 6803: sll0019Help
Entry
sll0019           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00900  Terpenoid backbone biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01130  Biosynthesis of antibiotics
Module
syn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    sll0019
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     sll0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAA10183
CyanoBase: sll0019
CYORF: sll0019
UniProt: Q55663
Position
complement(2469245..2470429)
Genome map
AA seq 394 aa AA seqDB search
MVKRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQA
EKLEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGK
DIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCLQGVPEGGLRRIILTASGG
AFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGLDYDHIDI
VIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLDLVKAGSLSFR
EPDHDKYPCMQLAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKTCDLYV
GQNTASPDLETILAADQWARRTVLENSACVATRP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacgcatttctatcctcggctccaccggttccattggtacccaaactctggac
attgttacccatcatcctgatgcttttcaggtggtcggtttagcggctgggggaaatgtt
gcattactagcccaacaggtggcggagtttcgcccagagattgttgcgattcgtcaggca
gaaaagttagaggacctaaaagcagcagtggccgaactaactgattaccaacccatgtac
gtggtgggggaagaaggggtggtggaagtggcccgttatggtgatgcagaaagtgtggtc
acaggtattgtcggttgtgcgggattattacccaccatggcggcgatcgccgccgggaaa
gatattgctttagccaataaggaaacgttaattgccggagctccggtggtgttacccctg
gtggaaaaaatgggggtgaagttattgccggcggattcagaacattcagccatttttcaa
tgtttacagggggttcccgaaggggggttacggcggatcattctcaccgcttccggggga
gcattccgggacttgccggtggaaagattaccgtttgtaacagtacaggatgccctcaaa
catcccaactggtctatgggacaaaaaatcaccattgattccgccacattgatgaacaag
ggtttggaggtgattgaagcccattatctatttggcttggactacgatcatatagacatt
gtcattcatccccaaagcattattcattctttaattgaggtgcaggatacttctgtgcta
gctcaactggggtggcctgatatgcgtttgccgttgctctatgccctatcttggccagaa
agaatttacaccgactgggaacctttggatttagttaaagccggtagcttgagttttcgg
gagccagatcacgataaatatccctgcatgcaattggcctatggggccgggcgagctggg
ggagccatgccagcggtgttaaatgcggccaatgaacaggcggtggctttatttttgcaa
gaaaaaattagctttttggatattccccgtctgattgaaaagacctgtgacctctacgtt
ggtcaaaatactgctagccctgatttagaaacaattttggcagcggatcaatgggcccgg
cggacggtgttggaaaatagcgcctgtgtggctactcggccataa

DBGET integrated database retrieval system