KEGG   Synechocystis sp. PCC 6803: sll0037Help
Entry
sll0037           CDS       T00004                                 

Definition
hypothetical protein
Orthology
K03795  
sirohydrochlorin cobaltochelatase [EC:4.99.1.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sll0037
Enzymes [BR:syn01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.3  sirohydrochlorin cobaltochelatase
     sll0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3158106..3159116)
Genome map
AA seq 336 aa AA seqDB search
MTLTSVPAPVSLFPELELPPLPYHRPLLMIGHGTRDEDGRQTFLDFVAQYQALDHSRPVI
PCFLELTEPNIQAGVQQCVDQGFEEISALPILLFAARHNKFDVTNELDRSRQAHPQINFF
YGRHFGITPAILDLWKARLNQLDSPEANPQGIDRQDTVLLFVGRGSSDPDANGDVYKMAR
MLWEGSGYQTVETCFIGISHPRLEEGFRRARLYQPKRIIVLPYFLFMGALVKKIFTITEE
QRATFPEIEIQSLSEMGIQPELLALVREREIETQLGQVAMNCEACKFRLAFKNQGHGHDH
GHGHHHHGHDHGHSHGEWVDTYIEPTAYHEKIWQAP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaaccagtgtgcccgcccctgtttccctttttcctgaacttgagcttcccccc
cttccctatcacagacccctactgatgattggccatggcactagggacgaagacggtcgc
caaacatttttagattttgtggcccagtaccaagcattagaccattcccgcccggtgatc
ccctgttttttggagttgacggaacccaatatccaggccggggtgcagcaatgtgtagac
cagggctttgaggaaatttccgctctgcccattttgctctttgcggcccgccataacaaa
ttcgatgtcaccaatgagttagaccgcagtcgccaagcccatccccagatcaattttttc
tacggtcgtcattttggcattaccccagccattcttgatttgtggaaagcacggttgaat
caattggatagtcccgaagccaatccccagggcattgaccgccaagatacggtgctgttg
tttgtgggtcggggttccagtgatcccgatgccaacggtgatgtgtataaaatggcccgc
atgctctgggaaggcagtggctaccaaactgtagaaacctgtttcattggcattagccat
ccccgcttagaagaagggttccgtcgggcgaggttatatcaacccaagcggattattgtt
ttgccctactttttgtttatgggtgccttggtgaagaaaattttcaccatcactgaggag
caacgggccacttttcccgagattgaaattcaatccctgtcggaaatgggcattcaaccg
gagttattggcgttggtgcgggaacgggaaattgaaacccaattgggacaggtggcgatg
aattgtgaggcctgtaagtttcgcctcgcttttaaaaatcagggccatggtcatgatcac
ggccacggacatcaccatcatggtcacgaccacggccacagtcacggggaatgggtcgat
acttacatcgagcccacggcctaccacgaaaaaatttggcaggctccctag

DBGET integrated database retrieval system