KEGG   Synechocystis sp. PCC 6803: sll0593Help
Entry
sll0593           CDS       T00004                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sll0593 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sll0593 (glk)
   00052 Galactose metabolism
    sll0593 (glk)
   00500 Starch and sucrose metabolism
    sll0593 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    sll0593 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sll0593 (glk)
   00524 Butirosin and neomycin biosynthesis
    sll0593 (glk)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     sll0593 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2945070..2946137)
Genome map
AA seq 355 aa AA seqDB search
MGAMGVNFLAGDIGGTKTILALVTINESSPGLARPVTLFEQTYSSPAFPDLVPMVQQFRQ
EAAFVLGNPISVAKACFAIAGPVIDNTCRLTNLDWHLSGDRLAQELAIAQVDLINDFAAV
GYGILGLGSEDLTVLQAAPVDPSGAIAILGAGTGLGQCYVIPQGQGRYRVFASEGAHGDF
APRSPLEWQLLEYLKKKYSLGRISIERVVSGMGIAMIYEFLRHQYPERESAQFSKLYQTW
NREKDQETKTVDLAAAVSQAALEGTDVLADQAMELFLGAYGAEAGNLALKLLPRGGLYVA
GGIAPKIIPLLEKGSFMQGFSDKGRMQSLMGTIPVQVVLNAKVGLIGAAVCAAQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggggccatgggcgtaaattttttggcaggggatatcggcggcactaaaacgattctg
gccctggtgacgataaacgagagtagcccagggttggcccggccggtgactctgtttgaa
cagacctacagcagtccagcttttcccgatctggtgcccatggtgcaacaattccgtcaa
gaagcagcctttgtgttgggtaacccaatctccgttgctaaggcctgtttcgccattgcc
ggccctgtgatcgataacacctgtcgcctcactaatttagattggcatctcagcggcgat
cgcctggcccaggaattggccattgcccaggttgacctcatcaatgattttgccgctgtg
ggttacggcattttagggctagggtcagaggatttaaccgtactccaggccgctcccgtg
gatccgtcaggggcgatcgccatattgggagcaggcaccggcttgggacaatgctacgta
attccccagggccaaggaagatatcgagtttttgcctccgaaggagcccacggtgacttt
gccccccgatcgcctttggaatggcagttattggagtatctcaaaaagaagtattcccta
gggcggatttccattgaacgggtggtatccggcatgggcatcgccatgatttacgaattt
ttgcggcaccaatacccagaacgggaatcagcccaattcagcaaactctaccaaacctgg
aatcgagaaaaggaccaagaaaccaaaaccgtcgatctggccgccgccgtatcccaagcc
gccctggaaggcacagatgtattggctgaccaagccatggaactttttctcggggcctat
ggagcagaggcaggaaatcttgctttgaagctactacccagaggtggtttgtacgttgcc
ggtggtattgcccccaaaattatccctttactggaaaagggcagttttatgcaaggcttt
agcgacaaaggcaggatgcaaagcttaatggggacaattcccgtacaggtggtactcaac
gccaaagttggcctaattggcgcggcggtttgtgcggcccagtcttag

DBGET integrated database retrieval system