KEGG   Synechocystis sp. PCC 6803: sll0876Help
Entry
sll0876           CDS       T00004                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sll0876 (ruvA)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     sll0876 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1132264..1132899)
Genome map
AA seq 211 aa AA seqDB search
MIQFLQGQVVTVTKNIQNRWFLILSVNGVGYELQVPHSLAQQWTPPPPEPQQVFTHLLVR
QDQIALFGFGRLAERDLFGQLMGVTGIGAQLAIALIETLGLEGLVQAVVTGNVKQLCQTP
GVGKKGAERLALELKTKLSQWHKLQMGTGETDSTLPTTALLEDLEMTLLALGYTQTEIQQ
AIAMVSQVPDVAQSEDPEVWIRQAIGWLSDH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttcagggccaggttgttacagtcacaaaaaatattcagaaccgttgg
tttttgattttgtccgttaatggggtgggttatgagttgcaggtgccccattccttagcc
caacaatggactccgccccccccggaaccccaacaggtttttacccacctcttggtacgc
caagaccagatcgctctttttggttttggccgcctggcagaaagggatttatttggtcaa
ttaatgggagtaaccggcattggggcccagttggcgatcgccctaattgaaacgttgggc
ttggaaggcttagtgcaagcggtggtaacgggcaatgtcaaacaattgtgccaaacgccg
ggggtcgggaaaaagggagcggaaaggttagccctagaactaaaaactaaattatcccaa
tggcacaaactacaaatggggaccggggaaactgactctactctgcccaccactgccctc
ctggaagacctggaaatgaccttgttagcattgggttacacccaaacggaaatccagcag
gcgatcgccatggtcagtcaagttccagacgtggcccagagtgaagatccagaagtgtgg
atccgccaggcgatcggttggttaagtgatcactga

DBGET integrated database retrieval system