KEGG   Synechocystis sp. PCC 6803: sll0895Help
Entry
sll0895           CDS       T00004                                 

Gene name
cysQ
Definition
ammonium transporter
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:syn00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3238873..3239748)
Genome map
AA seq 291 aa AA seqDB search
MVISELLPNLDSGLTTLRTAGWGAMEILQSYYSGQNQTNLNANEDKQDGPVTAADLAANQ
YILATLQATFNPEEFGYLSEETHQGNEPLPQDWVWIIDPLDGTRDFIDKTGEYALHIALT
YRQRPVLALVGMPEAQKLYYAIQGQGCFRETKAGAITPVKVKPKTELESLTLVVSRSHRD
QRFQDLIDRLPFGDRHYVGSVGCKIVTILEGQSDVYISLSGKSAAKDWDFAAPELILTEA
GGEFTYFDQTPVLYNRGDVRQWGGILASNGSHHGALCEQAVEILAELDQNN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtcataagcgagcttttacccaacctagattccggcttaactactctccgcaccgcc
ggctggggcgcaatggaaattcttcagtcctactacagtggccagaatcagaccaattta
aatgccaacgaagataaacaggatggccccgtaacagcggcggatttggcggccaatcaa
tatattttggctactttgcaagctacctttaacccggaagaatttggctatctaagcgaa
gaaacccaccagggcaacgaaccattaccccaggattgggtttggattattgaccccctc
gatggcaccagggacttcattgataaaaccggggaatatgccctgcatattgctttgacc
tatcgccagcggccggtgttggccctagtgggcatgccggaagcccaaaagctttactat
gccatccaaggtcagggctgttttcgagaaaccaaagccggggcaataaccccagtgaag
gtgaagcctaaaactgaattagaatctttaaccctagtagtgagccgtagccatcgggac
caacgtttccaagatttgattgaccgtttaccctttggcgatcgccattatgtgggcagt
gtgggctgtaaaatcgtcacgattttggagggacagagcgatgtgtacatttccctctcc
ggtaaatccgccgctaaggattgggactttgcggccccggagttgattctcaccgaagcg
gggggagagtttacctattttgaccagacccctgtgttgtataaccggggcgacgtgcgg
caatggggcggtatcctggctagcaatggttcccaccatggagctttgtgtgagcaagcc
gtggaaattttagctgaactagatcaaaataattaa

DBGET integrated database retrieval system