KEGG   Synechocystis sp. PCC 6803: sll1023Help
Entry
sll1023           CDS       T00004                                 

Gene name
sucC
Definition
succinate--CoA ligase
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:syn00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:syn00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:syn00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(391899..393104)
Genome map
AA seq 401 aa AA seqDB search
MDLLEYQAKELFQQVGIPILPSQTIQNTTALKRLQIPYPMVLKSQVRAGGRGKAGGVRFV
ENTIDAIAAASAIFHLPIADEYPEVILAEARYDAQSELFLAIVLDYQRQCPVLMGSSEGG
IDVETLLEQMQSVSLRTNFSPYLARRLAVKMGLTGPLVTAVSGIIGKMYELFVTYDLDVI
EINPLGISADGEVMALDGKITVNDTAINRHPDLINWRSEQWTGHSWLPGNLAQGQIGLIC
NSEGLALSTWDLLNSFGITGAYLLDEGRSDITLGEQLELAFNHLSQAPNLKGIFVNLATR
ATDTSALAEDLRSFLPLPPNLSSEDRSLRGTGPSLPQRQRVPQRQTYTGEVLPVVIRFSQ
GNLDHLQQMYDNSLVHWHNDLETAIAKMLSLMPQETALAQG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggacttgttagagtaccaggccaaggaactatttcagcaagtgggcattcccattttg
ccttcccagactatccaaaacaccactgccctcaaacggttgcaaattccctaccccatg
gtgctcaaatcccaggtgcgggcggggggccggggtaaggccggcggggttaggtttgtg
gaaaataccattgatgccattgccgccgcttcggccattttccatttgcccattgcggat
gagtacccagaggtgattttggctgaggcccgctacgatgcccagtcggaattatttttg
gcgatcgtgctggactaccaacggcagtgccctgtgttaatgggttccagcgaggggggc
attgatgtggaaaccctgttggagcaaatgcagagcgtttccctgcggactaacttttct
ccctatctagcccgacggctagcggtgaaaatgggtttgaccgggcccctggtgactgcg
gtgagcggcatcatcggcaaaatgtatgaattgtttgtcacctatgacttggacgtgatt
gaaattaatcccctgggtattagtgctgacggggaggtgatggccctggacggcaaaatt
acagtcaacgatacggcgatcaaccggcatccggatttgatcaattggcgatcggagcaa
tggacggggcatagttggctgccggggaacttggcccagggacaaattggcctaatttgt
aacagtgaagggctagccctgagtacgtgggacctgctcaattccttcggcatcaccggc
gcctatttattggatgaaggtcgcagtgacataaccctgggggaacaactggaattggcc
tttaaccacctcagccaggcccccaatttaaaaggaatttttgttaacctggccaccaga
gcaacggacacctcggccttggcggaagatttacggtcttttttacccctgccccccaac
ctctccagtgaagaccgcagtttacgggggacgggccccagtttgccccagcgccaacgg
gttccccaacggcaaacctatacaggggaagtgctaccggtggttatccgatttagccag
ggaaatttagatcatctccagcagatgtacgacaacagccttgtccattggcacaatgat
ttggaaacggcgatcgccaagatgctgagtttgatgccccaagagacggcattggcccag
ggataa

DBGET integrated database retrieval system