KEGG   Synechocystis sp. PCC 6803: sll1172Help
Entry
sll1172           CDS       T00004                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sll1172 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sll1172 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    sll1172 (thrC)
Enzymes [BR:syn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     sll1172 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1873698..1874846)
Genome map
AA seq 382 aa AA seqDB search
MISCHSFTMTPSAPNSTVLPSATPVCPQSSACRWRGLIETYRPYLPVSDQTPVVTLLEGN
TPLIPAPAIAKRIGKDVRVFVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNT
SAAAAAYARRAGLRAFVIIPDGYVALGKLGQALIYGAEVIAIDGNFDDALTTVRQLSEHY
PVTLVNSVNPYRLEGQKTAAFEIVDVLGQAPDWLCIPVGNAGNITAYWMGFCQYKELGKG
DRLPRMMGFQAAGSAPFIQGQPISHPETLATAIRIGNPANWDKAWAASRESNGEFHPVTD
AEILEAYRILAAEEGVFCEPASAASVAGLLKQKDQVPAGATVVCVLTGNGLKDPDCAVQN
SGNQVKAGLKPDLEIVAKAMGF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttgtcattctttcaccatgaccccatccgccccaaattcgacagtgttgccc
agtgctacccccgtctgtccccagagttcggcctgtcgttggcgtggattgattgaaacc
tatcggccctatttaccggtatccgaccagactccagtggtcacccttttagaaggcaat
actcccctgattcccgctccggcgatcgccaaacgcattggcaaggacgtaagggttttt
gttaaatatgacggcctaaaccccaccggtagtttcaaggaccggggcatgaccatggcc
atttccaaagccaaggaagcaggggccaaagcggtaatttgtgccagcacaggtaatact
tcagcggcggcggcggcctacgctcggcgggccggtttgcgggcttttgtgatcattccc
gatggttatgtcgctttgggaaaattaggccaagctttaatttacggtgcggaagtgatt
gccattgatggtaactttgacgatgcgttgaccaccgtgcggcagttatcggaacattac
cccgtaaccttggtaaattccgttaatccctaccgtttggaaggacaaaagaccgccgcg
tttgaaattgttgatgtcctcggccaggcccccgattggctctgtatccccgtgggcaat
gcgggcaatatcaccgcctactggatgggtttttgtcagtataaagaattgggcaaaggc
gatcgcctaccgaggatgatgggtttccaagccgctggttccgctccttttatccaaggg
caacccattagccatcccgaaaccctagccactgctattcgtattggcaatcctgccaac
tgggataaggcctgggccgcttctagggaaagtaatggggaatttcaccccgtcaccgat
gccgaaattttggaagcctatcgtatcctagctgccgaagaaggggttttttgtgagccc
gccagtgccgcttccgtagctggtttattgaagcaaaaagatcaagttcccgctggagcc
accgtggtttgtgtgctgaccggcaacggcttgaaagatccagattgtgctgtgcaaaat
agtggcaatcaagtgaaagcgggtttaaaaccagatttggaaattgttgctaaagcgatg
ggtttttag

DBGET integrated database retrieval system