KEGG   Synechocystis sp. PCC 6803: sll1188Help
Entry
sll1188           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K09705  
uncharacterized protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(313705..314199)
Genome map
AA seq 164 aa AA seqDB search
MKKEINYWVEKLELLPHPEGGFYKETYRSPVEANFAGFDGSRNVVTGIYFLMTKDNFSAF
HRIKSDEMWHFYAGDSLEIYWFSPQGELEVISLGLDLEKGEVPQAVVLKDGWFASRVKNG
GDYALVGCTVAPGFDFQDFELANREDLLKLYPRSAEIINQLTRQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaattaattattgggtagaaaagttggagctactcccccatcctgaaggg
ggattttataaggaaacctatcgatcgccagtagaggcaaattttgcaggatttgacggc
agtagaaatgtagttaccggaatttattttttgatgaccaaggacaacttttccgctttc
cacaggattaaatccgatgaaatgtggcatttctatgccggtgatagcttggaaatttac
tggttttctccccagggagagctggaggtgatcagcctgggcttggatttggaaaaagga
gaagtgccccaagcggtggttctcaaggatggttggtttgcttctcgggttaaaaacggc
ggagattatgccctagtgggttgcaccgttgcccctggattcgattttcaggattttgag
ttggccaatcgggaagatttgctcaagctctacccccgctccgccgagattattaaccag
ttaactaggcaatag

DBGET integrated database retrieval system