KEGG   Synechocystis sp. PCC 6803: sll1196Help
Entry
sll1196           CDS       T00004                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sll1196 (pfkA)
   01230 Biosynthesis of amino acids
    sll1196 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sll1196 (pfkA)
   00030 Pentose phosphate pathway
    sll1196 (pfkA)
   00051 Fructose and mannose metabolism
    sll1196 (pfkA)
   00052 Galactose metabolism
    sll1196 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    sll1196 (pfkA)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     sll1196 (pfkA)
Protein phosphatases and associated proteins [BR:syn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     sll1196 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(293878..294963)
Genome map
AA seq 361 aa AA seqDB search
MGEIKRIGILTSGGDCAGLNAVIRSVVHHAIGTYGWEVIGIQEATQGLMENPSKAIALHR
DNIDHLLMMGGTFLGTTNKGNPFAFPMADGTVRDRTEDIIAGYRQLGLDALIGIGGDGSL
AILRRIAQQGGINLVGIPKTIDNDVGATEISIGFDTATNIATEALDRLHFTAASHNRVMV
LEVMGRDAGHIALAAGIGGGADIILIPEIPYRIQSVCNKIRQRQAEGKNFCLVMVSEAVR
TELGDQVKQIQQFGEDRYGGIGKYIAEQIAQRTGAETRVTVLGHIQRGGIPSPFDRLLGS
VFGVAAVDLIAEGKFDHMVAWRNRQTISVPIEEAIQTYQTVQLDGTLVKTARGLGICLGN
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaattaaacgcattggtattttaaccagtggaggagactgtgccggactaaac
gccgtaattcgctccgtggtacaccatgccattggcacctacggttgggaagtaattggc
attcaagaagccacccagggactaatggaaaatccctccaaggcgatcgccctgcaccgg
gataacattgaccatttgttaatgatgggaggtacctttttaggcaccaccaataagggt
aatccgttcgcttttcccatggccgacggcactgtgcgggaccgcaccgaagatattatt
gccggttatcgtcagttggggcttgacgctctcattggcattggcggagacggtagttta
gccattttgcgccgcatagcccaacaggggggcatcaacttagtgggcattcccaaaacc
attgacaatgatgtgggggcaacggaaatttccattggtttcgacaccgccaccaacatt
gccaccgaagccttggatcgtttgcatttcaccgccgctagccataaccgggtcatggtg
ctagaagtgatgggtagggatgcgggccacattgccctggccgccggcattgggggaggg
gcggacattattctcattcctgaaattccctaccgcatccaaagtgtgtgcaataaaatt
cgtcaacggcaggccgaggggaaaaacttttgcctggttatggtgtcggaagcggtgcgg
acagaattgggcgatcaggtcaagcaaatccaacagtttggcgaagaccgctacggcggc
attggtaaatacattgcggaacaaattgcccaacgcactggagcagaaaccagagtcact
gtgctgggccacatccaacgggggggcattccttcacctttcgatcgcctgttggggagt
gtgtttggggtcgcggcggtggacttgattgcggaaggcaaattcgaccacatggtggcc
tggcgcaatcgtcaaaccattagtgtgcccattgaggaagccatccaaacctatcaaacg
gtgcagttggacggcaccttggtgaaaactgcgcggggattgggcatttgccttggtaac
gattaa

DBGET integrated database retrieval system