KEGG   Synechocystis sp. PCC 6803: sll1451Help
Entry
sll1451           CDS       T00004                                 

Gene name
nrtB
Definition
nitrate transport protein NrtB
Orthology
K15577  
nitrate/nitrite transport system permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    sll1451 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    sll1451 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1008321..1009148)
Genome map
AA seq 275 aa AA seqDB search
MASSTAGLRPRRKKNPLSFIYSPKVIRPAVAIAVLLVVWQILCSGEGSNLPSPVQVLEQT
YPLILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPI
FQVLRTIPPLAWLPIALAALQEAEPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRV
LKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSL
ISEIIIALIYVGIVGLLLDRFIAFLESLVVPAEQK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctagttccaccgctgggctccgtccccgccgcaagaaaaatcccctcagtttcatt
tacagtcccaaggttattcgtcccgccgtggcgatcgccgttttgttggtggtttggcag
attctctgctccggagaaggttctaatctgcccagtcccgtgcaggtcttagaacaaacc
tatcctttaattctcaatcccttttttgacaatggtggcacagacaagggtttaggcatc
caaatttttgccagtttaaccagggtggcagtgggcttcagtgcggcggcggtggtgggc
attgccctaggcatcttaattggtagtagcaaatttatgtatgatgccctcgatccaatt
tttcaggttctaagaaccattcctcccttggcctggttgcccattgctctggcggctttg
caggaagcagagccttcggccattttcgttattttcattacggcaatttggcccatcgtc
atcaacaccacggtgggagctcaacaggttccccaggattatcggaatgtttcccgggtt
ctaaaactctccaaaagccaatactttttcaatattctattcccggcagcagtgccctac
attttcactggcctacgcattggcattggtctttcctggttggcgatcgtggcagcggaa
atgctgattggtggtgtgggcattggcttttttatctgggatgcctataacagctccctg
atcagtgaaatcattattgccttaatttatgtgggcattgtcggtttattgctagatcgt
tttatcgcttttctggaaagtttagtggtcccagcggagcaaaagtga

DBGET integrated database retrieval system