KEGG   Synechocystis sp. PCC 6803: sll1564Help
Entry
sll1564           CDS       T00004                                 

Gene name
leuA
Definition
(GenBank) alpha-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00290  Valine, leucine and isoleucine biosynthesis
syn00620  Pyruvate metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01210  2-Oxocarboxylic acid metabolism
syn01230  Biosynthesis of amino acids
Module
syn_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sll1564 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    sll1564 (leuA)
Enzymes [BR:syn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     sll1564 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: BAA18363
CyanoBase: sll1564
CYORF: sll1564
UniProt: P74269
Position
complement(1959436..1961079)
Genome map
AA seq 547 aa AA seqDB search
MATKKTSLWLYDTTLRDGAQREGISLSLTDKLTIARRLDQLGIPFIEGGWPGANPKDVQF
FWQLQEEPLEQAEIVAFCSTRRPHKAVETDKMLQAILSAGTRWVTIFGKSWDLHVLEGLQ
TSLAENLAMISDTIAYLRSQGRRVIYDAEHWFDGYRANPDYALATLATAQQAGAEWLVMC
DTNGGTLPGQISEITTKVRRSLGLDGQSDRQPQLGIHAHNDSGTAVANSLLAVEAGATMV
QGTINGYGERCGNANLCTLIPNLQLKLDYDCIEPEKLAHLTSTSRLISEIVNLAPDDHAP
FVGRSAFAHKGGIHVSAVQRNPFTYEHIAPNLVGNERRIVVSEQAGLSNVLSKAELFGIA
LDRQNPACRTILATLKDLEQQGYQFEAAEASFELLMRQAMGDRQPLFLVQGFQVHCDLLT
PAENPAYRNALATVKVTVNGQNILEVAEGNGPVSALDQALRKALTRFYPQIADFHLTDYK
VRILDGGAGTSAKTRVLVESSNGDRRWTTVGVSGNILEASYQAVVEGIEYGLRLLTCGLT
NQEAISS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaagaaaacttccctttggctctacgacaccaccctccgagacggggcccaa
agggagggaatttctttgtcgttgaccgataaattgaccattgcccgccgtttggatcaa
ttgggtattccctttattgagggaggttggcccggagccaatcctaaggatgtgcagttt
ttttggcaattacaggaagagcccttggagcaggcggaaattgtggccttttgctccact
cgtcgcccccacaaagcggtggaaacagacaaaatgctccaggcgattctctctgctgga
acccgctgggtaaccatttttggcaagtcctgggacctccatgtgctggagggattacaa
actagcttggcggaaaatttagctatgatcagcgacacgatcgcctatctacgtagccaa
gggcggcgggtgatatacgatgccgaacattggtttgatggctatcgagctaatccagat
tatgccttggcaaccttagccacagcccagcaggccggggcagaatggctcgtgatgtgt
gataccaatgggggtactttaccggggcaaatcagcgaaattaccactaaagttcgacgg
agtttaggactggacggtcaatccgatcgtcaaccccaactgggtatccatgcccacaac
gacagtggcacagcggtggccaattccctcctggcggtggaggctggagcgactatggtt
cagggcaccatcaatggctacggagagcgctgtggcaatgctaatctctgcactctgatt
cccaatttacaactgaaactcgattacgattgcattgaaccggaaaagctagcccatctc
actagtactagccgtttaatcagtgaaatagtcaacctggcccccgatgaccatgctcct
tttgtggggcgatcggcttttgcccataagggcggaatccacgtctcggcagtgcaacgt
aatccctttacctatgagcatattgccccgaatttggttggtaatgaacggcgtattgtg
gtgtcagaacaagcggggttgagcaatgttttatctaaagcggagttatttggcattgcc
ctagatcgtcagaatcccgcctgccgcactattttggcaaccctcaaagatttagaacag
caaggttaccaatttgaagcagcggaggccagctttgaactgcttatgcgtcaggccatg
ggcgatcgccaacccctatttttagtgcagggcttccaagtacactgtgatttgctgacc
ccggcggaaaatcctgcttatcgcaatgccttagccacggtgaaagtaactgttaatggg
caaaatatcttggaagtagcggaaggcaatggccccgtctcggccctagaccaagctctg
cgtaaagccttgacccgtttttatccccaaattgccgattttcacctgactgactacaaa
gtacggattttagatggaggggccggcacgtccgccaaaacccgtgtcctcgtcgaatcc
agcaatggcgatcgccgttggaccactgtaggagtatcgggcaatattttagaagcttcc
tatcaggcggtggtggaaggcattgaatacggcctgcgcttattaacctgtgggctaact
aatcaagaggcgatttccagttaa

DBGET integrated database retrieval system