KEGG   Synechocystis sp. PCC 6803: sll1564Help
Entry
sll1564           CDS       T00004                                 

Gene name
leuA
Definition
alpha-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:syn01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:syn01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:syn00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:syn00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1959436..1961079)
Genome map
AA seq 547 aa AA seqDB search
MATKKTSLWLYDTTLRDGAQREGISLSLTDKLTIARRLDQLGIPFIEGGWPGANPKDVQF
FWQLQEEPLEQAEIVAFCSTRRPHKAVETDKMLQAILSAGTRWVTIFGKSWDLHVLEGLQ
TSLAENLAMISDTIAYLRSQGRRVIYDAEHWFDGYRANPDYALATLATAQQAGAEWLVMC
DTNGGTLPGQISEITTKVRRSLGLDGQSDRQPQLGIHAHNDSGTAVANSLLAVEAGATMV
QGTINGYGERCGNANLCTLIPNLQLKLDYDCIEPEKLAHLTSTSRLISEIVNLAPDDHAP
FVGRSAFAHKGGIHVSAVQRNPFTYEHIAPNLVGNERRIVVSEQAGLSNVLSKAELFGIA
LDRQNPACRTILATLKDLEQQGYQFEAAEASFELLMRQAMGDRQPLFLVQGFQVHCDLLT
PAENPAYRNALATVKVTVNGQNILEVAEGNGPVSALDQALRKALTRFYPQIADFHLTDYK
VRILDGGAGTSAKTRVLVESSNGDRRWTTVGVSGNILEASYQAVVEGIEYGLRLLTCGLT
NQEAISS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaagaaaacttccctttggctctacgacaccaccctccgagacggggcccaa
agggagggaatttctttgtcgttgaccgataaattgaccattgcccgccgtttggatcaa
ttgggtattccctttattgagggaggttggcccggagccaatcctaaggatgtgcagttt
ttttggcaattacaggaagagcccttggagcaggcggaaattgtggccttttgctccact
cgtcgcccccacaaagcggtggaaacagacaaaatgctccaggcgattctctctgctgga
acccgctgggtaaccatttttggcaagtcctgggacctccatgtgctggagggattacaa
actagcttggcggaaaatttagctatgatcagcgacacgatcgcctatctacgtagccaa
gggcggcgggtgatatacgatgccgaacattggtttgatggctatcgagctaatccagat
tatgccttggcaaccttagccacagcccagcaggccggggcagaatggctcgtgatgtgt
gataccaatgggggtactttaccggggcaaatcagcgaaattaccactaaagttcgacgg
agtttaggactggacggtcaatccgatcgtcaaccccaactgggtatccatgcccacaac
gacagtggcacagcggtggccaattccctcctggcggtggaggctggagcgactatggtt
cagggcaccatcaatggctacggagagcgctgtggcaatgctaatctctgcactctgatt
cccaatttacaactgaaactcgattacgattgcattgaaccggaaaagctagcccatctc
actagtactagccgtttaatcagtgaaatagtcaacctggcccccgatgaccatgctcct
tttgtggggcgatcggcttttgcccataagggcggaatccacgtctcggcagtgcaacgt
aatccctttacctatgagcatattgccccgaatttggttggtaatgaacggcgtattgtg
gtgtcagaacaagcggggttgagcaatgttttatctaaagcggagttatttggcattgcc
ctagatcgtcagaatcccgcctgccgcactattttggcaaccctcaaagatttagaacag
caaggttaccaatttgaagcagcggaggccagctttgaactgcttatgcgtcaggccatg
ggcgatcgccaacccctatttttagtgcagggcttccaagtacactgtgatttgctgacc
ccggcggaaaatcctgcttatcgcaatgccttagccacggtgaaagtaactgttaatggg
caaaatatcttggaagtagcggaaggcaatggccccgtctcggccctagaccaagctctg
cgtaaagccttgacccgtttttatccccaaattgccgattttcacctgactgactacaaa
gtacggattttagatggaggggccggcacgtccgccaaaacccgtgtcctcgtcgaatcc
agcaatggcgatcgccgttggaccactgtaggagtatcgggcaatattttagaagcttcc
tatcaggcggtggtggaaggcattgaatacggcctgcgcttattaacctgtgggctaact
aatcaagaggcgatttccagttaa

DBGET integrated database retrieval system