KEGG   Synechocystis sp. PCC 6803: sll1564Help
Entry
sll1564           CDS       T00004                                 

Gene name
leuA
Definition
alpha-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    sll1564 (leuA)
   01230 Biosynthesis of amino acids
    sll1564 (leuA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sll1564 (leuA)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    sll1564 (leuA)
Enzymes [BR:syn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     sll1564 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1959436..1961079)
Genome map
AA seq 547 aa AA seqDB search
MATKKTSLWLYDTTLRDGAQREGISLSLTDKLTIARRLDQLGIPFIEGGWPGANPKDVQF
FWQLQEEPLEQAEIVAFCSTRRPHKAVETDKMLQAILSAGTRWVTIFGKSWDLHVLEGLQ
TSLAENLAMISDTIAYLRSQGRRVIYDAEHWFDGYRANPDYALATLATAQQAGAEWLVMC
DTNGGTLPGQISEITTKVRRSLGLDGQSDRQPQLGIHAHNDSGTAVANSLLAVEAGATMV
QGTINGYGERCGNANLCTLIPNLQLKLDYDCIEPEKLAHLTSTSRLISEIVNLAPDDHAP
FVGRSAFAHKGGIHVSAVQRNPFTYEHIAPNLVGNERRIVVSEQAGLSNVLSKAELFGIA
LDRQNPACRTILATLKDLEQQGYQFEAAEASFELLMRQAMGDRQPLFLVQGFQVHCDLLT
PAENPAYRNALATVKVTVNGQNILEVAEGNGPVSALDQALRKALTRFYPQIADFHLTDYK
VRILDGGAGTSAKTRVLVESSNGDRRWTTVGVSGNILEASYQAVVEGIEYGLRLLTCGLT
NQEAISS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaagaaaacttccctttggctctacgacaccaccctccgagacggggcccaa
agggagggaatttctttgtcgttgaccgataaattgaccattgcccgccgtttggatcaa
ttgggtattccctttattgagggaggttggcccggagccaatcctaaggatgtgcagttt
ttttggcaattacaggaagagcccttggagcaggcggaaattgtggccttttgctccact
cgtcgcccccacaaagcggtggaaacagacaaaatgctccaggcgattctctctgctgga
acccgctgggtaaccatttttggcaagtcctgggacctccatgtgctggagggattacaa
actagcttggcggaaaatttagctatgatcagcgacacgatcgcctatctacgtagccaa
gggcggcgggtgatatacgatgccgaacattggtttgatggctatcgagctaatccagat
tatgccttggcaaccttagccacagcccagcaggccggggcagaatggctcgtgatgtgt
gataccaatgggggtactttaccggggcaaatcagcgaaattaccactaaagttcgacgg
agtttaggactggacggtcaatccgatcgtcaaccccaactgggtatccatgcccacaac
gacagtggcacagcggtggccaattccctcctggcggtggaggctggagcgactatggtt
cagggcaccatcaatggctacggagagcgctgtggcaatgctaatctctgcactctgatt
cccaatttacaactgaaactcgattacgattgcattgaaccggaaaagctagcccatctc
actagtactagccgtttaatcagtgaaatagtcaacctggcccccgatgaccatgctcct
tttgtggggcgatcggcttttgcccataagggcggaatccacgtctcggcagtgcaacgt
aatccctttacctatgagcatattgccccgaatttggttggtaatgaacggcgtattgtg
gtgtcagaacaagcggggttgagcaatgttttatctaaagcggagttatttggcattgcc
ctagatcgtcagaatcccgcctgccgcactattttggcaaccctcaaagatttagaacag
caaggttaccaatttgaagcagcggaggccagctttgaactgcttatgcgtcaggccatg
ggcgatcgccaacccctatttttagtgcagggcttccaagtacactgtgatttgctgacc
ccggcggaaaatcctgcttatcgcaatgccttagccacggtgaaagtaactgttaatggg
caaaatatcttggaagtagcggaaggcaatggccccgtctcggccctagaccaagctctg
cgtaaagccttgacccgtttttatccccaaattgccgattttcacctgactgactacaaa
gtacggattttagatggaggggccggcacgtccgccaaaacccgtgtcctcgtcgaatcc
agcaatggcgatcgccgttggaccactgtaggagtatcgggcaatattttagaagcttcc
tatcaggcggtggtggaaggcattgaatacggcctgcgcttattaacctgtgggctaact
aatcaagaggcgatttccagttaa

DBGET integrated database retrieval system